Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

Western Blot: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62542] - Jurkat tissue lysate at a concentration of 1.25ug/ml.

Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody [NBP1-62542] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CHST1(carbohydrate (keratan sulfate Gal-6) sulfotransferase 1) The peptide sequence was selected from the N terminal of CHST1. Peptide sequence SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHST1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 29632893).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody - BSA Free

• 6-O-sulfotransferase 1
• C6ST
• carbohydrate (chondroitin 6/keratan) sulfotransferase 1
• carbohydrate (keratan sulfate Gal-6) sulfotransferase 1
• Carbohydrate Sulfotransferase 1
• CHST1
• EC 2.8.2
• Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1
• GST-1
• Keratan sulfate Gal-6 sulfotransferase
• KS6ST
• KSGal6ST
• KSGal6STEC 2.8.2.21
• KSST

Background

CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal Gal residues are sulfated. It may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbohydrate Sulfotransferase 1/CHST1/KS6ST Antibody (NBP1-62542)(1)

Publication using NBP1-62542

• Mohd ISa IL, Abbah Sa, Kilcoyne M et al. Implantation of hyaluronic acid hydrogel prevents the pain phenotype in a rat model of intervertebral disc injury. Sci Adv 2018-04-01 [PMID: 29632893] (Rat)

Bioinformatics

• Gene Symbol: CHST1
• Uniprot:
  • O43916()