CAPZA3 Recombinant Protein Antigen

Images

 
There are currently no images for CAPZA3 Protein (NBP2-38425PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CAPZA3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CAPZA3.

Source: E. coli

Amino Acid Sequence: KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAPZA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38425.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CAPZA3 Recombinant Protein Antigen

  • CAPAA3
  • CAPPA3F-actin capping protein alpha-3 subunit
  • capping protein (actin filament) muscle Z-line, alpha 3
  • CapZ alpha-3
  • CP-alpha-3
  • F-actin-capping protein subunit alpha-3
  • Germ cell-specific protein 3
  • Gsg3

Background

CAPZA3 encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1029
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-73861
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-85922
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02500
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-92643
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-77342
Species: Hu
Applications: PEP-ELISA, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
NBP1-83086
Species: Hu, Po
Applications: ICC, IHC, IHC-P, WB
NBP2-20042
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00007727-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-89300
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82470
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76669
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB

Publications for CAPZA3 Protein (NBP2-38425PEP) (0)

There are no publications for CAPZA3 Protein (NBP2-38425PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAPZA3 Protein (NBP2-38425PEP) (0)

There are no reviews for CAPZA3 Protein (NBP2-38425PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CAPZA3 Protein (NBP2-38425PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CAPZA3 Products

Bioinformatics Tool for CAPZA3 Protein (NBP2-38425PEP)

Discover related pathways, diseases and genes to CAPZA3 Protein (NBP2-38425PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAPZA3 Protein (NBP2-38425PEP)

Discover more about diseases related to CAPZA3 Protein (NBP2-38425PEP).
 

Pathways for CAPZA3 Protein (NBP2-38425PEP)

View related products by pathway.

Blogs on CAPZA3

There are no specific blogs for CAPZA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CAPZA3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPZA3