Recombinant Human CAMKID Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CAMKID Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 95 of Human CAMK1D partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLY

Protein/Peptide Type
Partial Recombinant Protein
Gene
CAMK1D

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CAMKID Protein

  • calcium/calmodulin-dependent protein kinase ID
  • calcium/calmodulin-dependent protein kinase type 1D
  • CaM kinase I delta
  • CaM kinase ID
  • CaM-K1
  • CaMKI delta
  • CaM-KI delta
  • CaMKID
  • CaMKI-like protein kinase
  • CKLiKEC 2.7.11.17
  • EC 2.7.11

Background

This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP2-57403
Species: Hu
Applications: WB, ICC/IF
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82916
Species: Hu
Applications: IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-82134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7899
Species: Hu
Applications: WB, IHC
NBP1-28904
Species: Hu, Po
Applications: ICC/IF (-), WB, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49620
Species: Hu
Applications: WB, IA, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003087-M02
Species: Hu
Applications: WB, ELISA
NB600-261
Species: Hu, Mu
Applications: WB, ChIP, Flow, IP
H00001646-M03
Species: Hu
Applications: WB, ELISA
AF7318
Species: Hu
Applications: IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00057118-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CAMKID Partial Recombinant Protein (H00057118-Q01) (0)

There are no publications for CAMKID Partial Recombinant Protein (H00057118-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMKID Partial Recombinant Protein (H00057118-Q01) (0)

There are no reviews for CAMKID Partial Recombinant Protein (H00057118-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAMKID Partial Recombinant Protein (H00057118-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CAMKID Products

Bioinformatics Tool for CAMKID Partial Recombinant Protein (H00057118-Q01)

Discover related pathways, diseases and genes to CAMKID Partial Recombinant Protein (H00057118-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAMKID Partial Recombinant Protein (H00057118-Q01)

Discover more about diseases related to CAMKID Partial Recombinant Protein (H00057118-Q01).
 

Pathways for CAMKID Partial Recombinant Protein (H00057118-Q01)

View related products by pathway.

PTMs for CAMKID Partial Recombinant Protein (H00057118-Q01)

Learn more about PTMs related to CAMKID Partial Recombinant Protein (H00057118-Q01).
 

Research Areas for CAMKID Partial Recombinant Protein (H00057118-Q01)

Find related products by research area.

Blogs on CAMKID

There are no specific blogs for CAMKID, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CAMKID Antibody (3H8)
H00057118-M10

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CAMKID Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAMK1D