Calponin 2 Antibody

Images

 
Western Blot: Calponin 2 Antibody [NBP1-54341] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Calponin 2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54341
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Calponin 2 Antibody Summary

Immunogen
Synthetic peptides corresponding to CNN2(calponin 2) The peptide sequence was selected from the N terminal of CNN2. Peptide sequence YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC.
Clonality
Polyclonal
Host
Rabbit
Gene
CNN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CNN2 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calponin 2 Antibody

  • calponin 2
  • Calponin H2, smooth muscle
  • calponin-2
  • Neutral calponin

Background

CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB100-2080
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3377
Species: Mu
Applications: WB, IHC
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-52477
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-92208
Species: Hu
Applications: IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Calponin 2 Antibody (NBP1-54341) (0)

There are no publications for Calponin 2 Antibody (NBP1-54341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calponin 2 Antibody (NBP1-54341) (0)

There are no reviews for Calponin 2 Antibody (NBP1-54341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calponin 2 Antibody (NBP1-54341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Calponin 2 Antibody (NBP1-54341)

Discover related pathways, diseases and genes to Calponin 2 Antibody (NBP1-54341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calponin 2 Antibody (NBP1-54341)

Discover more about diseases related to Calponin 2 Antibody (NBP1-54341).
 

Pathways for Calponin 2 Antibody (NBP1-54341)

View related products by pathway.

Blogs on Calponin 2

There are no specific blogs for Calponin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calponin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNN2
Uniprot