Calponin 2 Antibody

Product Discontinued

Calponin 2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to CNN2(calponin 2) The peptide sequence was selected from the N terminal of CNN2. Peptide sequence YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Guinea Pig (100%), Bovine (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against CNN2 and was validated on Western blot.
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calponin 2 Antibody

• calponin 2
• Calponin H2, smooth muscle
• calponin-2
• Neutral calponin

Background

CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNN2
• Uniprot:
  • Q99439(Human)