Calpain 9 Antibody - BSA Free

Immunohistochemistry-Paraffin: Calpain 9 Antibody [NBP2-48545] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Calpain 9 Antibody [NBP2-48545] - Analysis in human stomach and pancreas tissues. Corresponding CAPN9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calpain 9 Antibody [NBP2-48545] - Staining of human fallopian tube shows weak cytoplasmic positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Calpain 9 Antibody [NBP2-48545] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Calpain 9 Antibody [NBP2-48545] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calpain 9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calpain 9 Antibody - BSA Free (NBP2-48545) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPN9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calpain 9 Recombinant Protein Antigen (NBP2-48545PEP)

Reactivity Notes

Mouse (82%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calpain 9 Antibody - BSA Free

• calpain 9 (nCL-4)
• calpain 9
• calpain-9
• Digestive tract-specific calpain
• EC 3.4.22
• EC 3.4.22.54
• GC36
• NCL4
• nCL-4EC 3.4.22.-
• New calpain 4
• novel calpain large subunit-4
• Protein CG36

Background

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPN9