Recombinant Human Calpain 3 Protein

Images

 
SDS-Page: Recombinant Human Calpain 3 Protein [H00000825-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Calpain 3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CAPN3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CAPN3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calpain 3 Protein

  • calpain 3, (p94)
  • Calpain L3
  • Calpain p94
  • calpain, large polypeptide L3
  • calpain-3
  • CANP 3
  • CANP3MGC4403
  • CANPL3
  • EC 3.4.22
  • EC 3.4.22.54
  • LGMD2
  • LGMD2A
  • MGC10767
  • MGC11121
  • MGC14344
  • muscle-specific calcium-activated neutral protease 3 large subunit
  • Muscle-specific calcium-activated neutral protease 3
  • NCL1
  • nCL-1large [catalytic] subunit
  • New calpain 1

Background

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-55584
Species: Hu
Applications: ICC/IF
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB120-3588
Species: Hu, Mu, Rt, Po, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Calpain 3 Partial Recombinant Protein (H00000825-Q01) (0)

There are no publications for Calpain 3 Partial Recombinant Protein (H00000825-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain 3 Partial Recombinant Protein (H00000825-Q01) (0)

There are no reviews for Calpain 3 Partial Recombinant Protein (H00000825-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calpain 3 Partial Recombinant Protein (H00000825-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calpain 3 Products

Bioinformatics Tool for Calpain 3 Partial Recombinant Protein (H00000825-Q01)

Discover related pathways, diseases and genes to Calpain 3 Partial Recombinant Protein (H00000825-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calpain 3 Partial Recombinant Protein (H00000825-Q01)

Discover more about diseases related to Calpain 3 Partial Recombinant Protein (H00000825-Q01).
 

Pathways for Calpain 3 Partial Recombinant Protein (H00000825-Q01)

View related products by pathway.

PTMs for Calpain 3 Partial Recombinant Protein (H00000825-Q01)

Learn more about PTMs related to Calpain 3 Partial Recombinant Protein (H00000825-Q01).

Blogs on Calpain 3

There are no specific blogs for Calpain 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calpain 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPN3