CALML5 Recombinant Protein Antigen

Images

 
There are currently no images for CALML5 Protein (NBP1-84437PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CALML5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CALML5.

Source: E.coli

Amino Acid Sequence: GELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CALML5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84437.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CALML5 Recombinant Protein Antigen

  • calmodulin-like 5
  • calmodulin-like protein 5
  • CLSPCalmodulin-like skin protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4604
Species: Hu
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-33518
Species: Hu
Applications: WB, IHC, IHC-P
H00163688-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CALML5 Protein (NBP1-84437PEP) (0)

There are no publications for CALML5 Protein (NBP1-84437PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML5 Protein (NBP1-84437PEP) (0)

There are no reviews for CALML5 Protein (NBP1-84437PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CALML5 Protein (NBP1-84437PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CALML5 Products

Bioinformatics Tool for CALML5 Protein (NBP1-84437PEP)

Discover related pathways, diseases and genes to CALML5 Protein (NBP1-84437PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALML5 Protein (NBP1-84437PEP)

Discover more about diseases related to CALML5 Protein (NBP1-84437PEP).
 

Pathways for CALML5 Protein (NBP1-84437PEP)

View related products by pathway.

Blogs on CALML5

There are no specific blogs for CALML5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CALML5 Antibody
NBP1-84437
CALML5 Antibody
NBP1-84437
CALML5 Antibody
NBP1-84437

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CALML5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CALML5