Recombinant Human CALML5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CALML5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 47-146 of Human CALML5

Source: Wheat Germ

Amino Acid Sequence: AQLRKLISEVDSDGDGEISFQEFLTAARKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CALML5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CALML5 Protein

  • calmodulin-like 5
  • calmodulin-like protein 5
  • CLSPCalmodulin-like skin protein

Background

CALML5 - calmodulin-like 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86950
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00163688-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-83143
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CALML5 Partial Recombinant Protein (H00051806-Q01) (0)

There are no publications for CALML5 Partial Recombinant Protein (H00051806-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML5 Partial Recombinant Protein (H00051806-Q01) (0)

There are no reviews for CALML5 Partial Recombinant Protein (H00051806-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CALML5 Partial Recombinant Protein (H00051806-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CALML5 Partial Recombinant Protein (H00051806-Q01)

Discover related pathways, diseases and genes to CALML5 Partial Recombinant Protein (H00051806-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALML5 Partial Recombinant Protein (H00051806-Q01)

Discover more about diseases related to CALML5 Partial Recombinant Protein (H00051806-Q01).
 

Pathways for CALML5 Partial Recombinant Protein (H00051806-Q01)

View related products by pathway.

Blogs on CALML5

There are no specific blogs for CALML5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CALML5 Antibody
NBP1-84437

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CALML5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CALML5