Cadherin-18 Antibody (4H2)

Images

 
Western Blot: Cadherin-18 Antibody (4H2) [H00001016-M02] - Detection against Immunogen (37.84 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cadherin-18 Antibody (4H2) Summary

Immunogen
CDH18 (NP_004925 467 a.a. - 576 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIP
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDH18
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cadherin-18 Antibody (4H2)

  • cadherin 18, type 2
  • cadherin-14
  • cadherin-18
  • cadherin-like 24
  • CDH14EY-CADHERIN
  • CDH14L
  • CDH24
  • ey-cadherin

Background

This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87584
Species: Hu
Applications: WB, IHC, IHC-P
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-55461
Species: Hu
Applications: WB
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA
H00006496-M04
Species: Hu
Applications: WB, ELISA
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF7669
Species: Hu, Mu, Rt
Applications: WB
NBP2-12904
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
H00001016-M02
Species: Hu
Applications: WB, ELISA

Publications for Cadherin-18 Antibody (H00001016-M02) (0)

There are no publications for Cadherin-18 Antibody (H00001016-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-18 Antibody (H00001016-M02) (0)

There are no reviews for Cadherin-18 Antibody (H00001016-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-18 Antibody (H00001016-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-18 Products

Bioinformatics Tool for Cadherin-18 Antibody (H00001016-M02)

Discover related pathways, diseases and genes to Cadherin-18 Antibody (H00001016-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-18 Antibody (H00001016-M02)

Discover more about diseases related to Cadherin-18 Antibody (H00001016-M02).
 

Pathways for Cadherin-18 Antibody (H00001016-M02)

View related products by pathway.

Blogs on Cadherin-18

There are no specific blogs for Cadherin-18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-18 Antibody (4H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH18
Uniprot