Recombinant Human CACNG3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CACNG3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 199-297 of Human CACNG3

Source: Wheat Germ

Amino Acid Sequence: IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CACNG3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CACNG3 Protein

  • calcium channel, voltage-dependent, gamma subunit 3
  • Neuronal voltage-gated calcium channel gamma-3 subunit
  • voltage-dependent calcium channel gamma-3 subunit
  • voltage-gated calcium channel gamma subunit

Background

CACNG3 - calcium channel, voltage-dependent, gamma subunit 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NBP2-14432
Species: Hu
Applications: IHC, IHC-P
NBP2-55176
Species: Hu
Applications: IHC, IHC-P
H00000786-B01P
Species: Hu
Applications: WB, Flow
NBP1-86228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AB-230-NA
Species: Hu
Applications: WB, Neut
NB300-195
Species: Mu, Rt
Applications: WB, IHC
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-50323
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-07010
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010368-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CACNG3 Partial Recombinant Protein (H00010368-Q01) (0)

There are no publications for CACNG3 Partial Recombinant Protein (H00010368-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNG3 Partial Recombinant Protein (H00010368-Q01) (0)

There are no reviews for CACNG3 Partial Recombinant Protein (H00010368-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNG3 Partial Recombinant Protein (H00010368-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNG3 Products

Bioinformatics Tool for CACNG3 Partial Recombinant Protein (H00010368-Q01)

Discover related pathways, diseases and genes to CACNG3 Partial Recombinant Protein (H00010368-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNG3 Partial Recombinant Protein (H00010368-Q01)

Discover more about diseases related to CACNG3 Partial Recombinant Protein (H00010368-Q01).
 

Pathways for CACNG3 Partial Recombinant Protein (H00010368-Q01)

View related products by pathway.

Blogs on CACNG3

There are no specific blogs for CACNG3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD11b Antibody
NB110-89474
CACNG3 Antibody (3E4)
H00010368-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CACNG3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNG3