CACNB1 Antibody (1G6)

Images

 
Western Blot: CACNB1 Antibody (1G6) [H00000782-M01] - Analysis of CACNB1 over-expressed 293 cell line, cotransfected with CACNB1 Validated Chimera RNAi ( Cat # H00000782-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: CACNB1 Antibody (1G6) [H00000782-M01] - Analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody (M01), clone 1G6.Lane 1: CACNB1 transfected lysate(65.7 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
1G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

CACNB1 Antibody (1G6) Summary

Immunogen
CACNB1 (NP_000714, 500 a.a. - 598 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Specificity
CACNB1 (1G6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CACNB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi validaton and ELISA.
Publications
Read Publication using H00000782-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CACNB1 Antibody (1G6)

  • CAB1
  • CACNLB1calcium channel, L type, beta 1 polypeptide
  • Calcium channel voltage-dependent subunit beta 1
  • calcium channel, voltage-dependent, beta 1 subunit
  • CCHLB1
  • dihydropyridine-sensitive L-type, calcium channel beta-1 subunit
  • MGC41896
  • voltage-dependent L-type calcium channel subunit beta-1

Background

The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF5489
Species: Hu
Applications: WB, IHC
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
NB300-542
Species: Hu, Mu, Rt, GP, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
AF4856
Species: Hu, Mu, Rt
Applications: WB
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP1-52926
Species: Hu
Applications: WB
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2864
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
H00010948-M01
Species: Hu
Applications: WB, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-22444
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CACNB1 Antibody (H00000782-M01)(1)

Reviews for CACNB1 Antibody (H00000782-M01) (0)

There are no reviews for CACNB1 Antibody (H00000782-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNB1 Antibody (H00000782-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNB1 Products

Bioinformatics Tool for CACNB1 Antibody (H00000782-M01)

Discover related pathways, diseases and genes to CACNB1 Antibody (H00000782-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB1 Antibody (H00000782-M01)

Discover more about diseases related to CACNB1 Antibody (H00000782-M01).
 

Pathways for CACNB1 Antibody (H00000782-M01)

View related products by pathway.

PTMs for CACNB1 Antibody (H00000782-M01)

Learn more about PTMs related to CACNB1 Antibody (H00000782-M01).

Blogs on CACNB1

There are no specific blogs for CACNB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNB1 Antibody (1G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNB1
Entrez
OMIM
Uniprot