Recombinant Human CACNA2D2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CACNA2D2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 65-162 of Human CACNA2D2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY

Protein/Peptide Type
Partial Recombinant Protein
Gene
CACNA2D2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CACNA2D2 Protein

  • alpha 2 delta calcium channel subunit
  • CACNA2D
  • calcium channel, voltage-dependent, alpha 2/delta subunit 2
  • gene 26
  • KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2
  • LUAC11.1
  • voltage-dependent calcium channel subunit alpha-2/delta-2

Background

CACNA2D2 - calcium channel, voltage-dependent, alpha 2/delta subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-2864
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NB100-56357
Species: Hu
Applications: WB, IP
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83409
Species: Hu
Applications: IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80898
Species: Hu
Applications: WB, IHC, IHC-P
NB300-913
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
H00009254-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CACNA2D2 Partial Recombinant Protein (H00009254-Q01) (0)

There are no publications for CACNA2D2 Partial Recombinant Protein (H00009254-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA2D2 Partial Recombinant Protein (H00009254-Q01) (0)

There are no reviews for CACNA2D2 Partial Recombinant Protein (H00009254-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNA2D2 Partial Recombinant Protein (H00009254-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CACNA2D2 Products

Bioinformatics Tool for CACNA2D2 Partial Recombinant Protein (H00009254-Q01)

Discover related pathways, diseases and genes to CACNA2D2 Partial Recombinant Protein (H00009254-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA2D2 Partial Recombinant Protein (H00009254-Q01)

Discover more about diseases related to CACNA2D2 Partial Recombinant Protein (H00009254-Q01).
 

Pathways for CACNA2D2 Partial Recombinant Protein (H00009254-Q01)

View related products by pathway.

PTMs for CACNA2D2 Partial Recombinant Protein (H00009254-Q01)

Learn more about PTMs related to CACNA2D2 Partial Recombinant Protein (H00009254-Q01).

Blogs on CACNA2D2

There are no specific blogs for CACNA2D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FUS Antibody
NB100-565

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CACNA2D2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNA2D2