CACNA2D2 Antibody [DyLight 755]

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 755

CACNA2D2 Antibody [DyLight 755] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CACNA2D2 (NP_001167522.1).
  
  Sequence:
  RPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CACNA2D2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for CACNA2D2 Antibody [DyLight 755]

• alpha 2 delta calcium channel subunit
• CACNA2D
• CACNA2D2
• calcium channel, voltage-dependent, alpha 2/delta subunit 2
• gene 26
• KIAA0558
• KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2
• LUAC11.1
• voltage-dependent calcium channel subunit alpha-2/delta-2

Background

The CACNA2D2 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-2 protein that exists in 5 isoforms: isoform 1: 1,150 amino acids long, 129 kDA; isoform 2: 1,143 amino acids long, 129 kDA; isoform 3: 1,145 amino acids long, 129 kDA; isoform 4: 1,076 amino acids long, 122 kDA; and isoform 5: 1,152 amino acids long, 130 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, as well as T-type. Overexpression of this gene triggers apoptosis. The CACNA2D2 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, regulation of insulin secretion, and transmission across chemical synapses. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D2 gene is associated with ataxia, seizures, lung cancer, and neuronitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CACNA2D2