CACNA2D2 Antibody [CoraFluor™ 1] Summary
| Description |
CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
CoraFluor(TM) 1, amine reactive
CoraFluor(TM) 1, thiol reactive
For more information, please see our CoraFluor(TM) TR-FRET technology flyer. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human CACNA2D2 (NP_001167522.1).
Sequence: RPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGASAYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRLDFIEDPNFKNK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CACNA2D2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. Do not freeze. |
| Buffer |
PBS |
| Preservative |
No Preservative |
| Purity |
Affinity purified |
Notes
CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254
Alternate Names for CACNA2D2 Antibody [CoraFluor™ 1]
Background
The CACNA2D2 gene encodes a voltage-dependent calcium channel subunit alpha-2/delta-2 protein that exists in 5 isoforms: isoform 1: 1,150 amino acids long, 129 kDA; isoform 2: 1,143 amino acids long, 129 kDA; isoform 3: 1,145 amino acids long, 129 kDA; isoform 4: 1,076 amino acids long, 122 kDA; and isoform 5: 1,152 amino acids long, 130 kDA. These proteins are critical in calcium current density and in activation and inactivation kinetics of the calcium channel. Additionally, these proteins function as regulatory subunits for P/Q-type calcium channel, N-type, and L-type, as well as T-type. Overexpression of this gene triggers apoptosis. The CACNA2D2 gene participates in transcription of the CREB pathway, the caspase cascade, Fc-GammaR pathway, BMP and PDGF pathways, regulation of insulin secretion, and transmission across chemical synapses. It is known to interact with genes DLG4, CACNA1C, CACNA1D, CACNA1F, and YWHAB. The CACNA2D2 gene is associated with ataxia, seizures, lung cancer, and neuronitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: IHC, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for CACNA2D2 Antibody (NBP3-35118CL1) (0)
There are no publications for CACNA2D2 Antibody (NBP3-35118CL1).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CACNA2D2 Antibody (NBP3-35118CL1) (0)
There are no reviews for CACNA2D2 Antibody (NBP3-35118CL1).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CACNA2D2 Antibody (NBP3-35118CL1) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CACNA2D2 Products
Blogs on CACNA2D2