BRPF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BRPF3 Antibody [NBP1-81419] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: BRPF3 Antibody [NBP1-81419] - Staining of human stomach shows strong positivity in mucous cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRPF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SDNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSPASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSGGLAFEACSGLTPPKRSRG
Specificity
Specificity of human BRPF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRPF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BRPF3 Protein (NBP1-81419PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRPF3 Antibody

  • bromodomain and PHD finger containing, 3
  • bromodomain and PHD finger-containing protein 3
  • KIAA1286

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88351
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-65842
Species: Hu
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80324
Species: Hu
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00051147-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-44049
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-55251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
MAB2695
Species: Hu
Applications: WB
NBP1-81419
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BRPF3 Antibody (NBP1-81419) (0)

There are no publications for BRPF3 Antibody (NBP1-81419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRPF3 Antibody (NBP1-81419) (0)

There are no reviews for BRPF3 Antibody (NBP1-81419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BRPF3 Antibody (NBP1-81419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BRPF3 Antibody (NBP1-81419)

Discover related pathways, diseases and genes to BRPF3 Antibody (NBP1-81419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRPF3 Antibody (NBP1-81419)

Discover more about diseases related to BRPF3 Antibody (NBP1-81419).

PTMs for BRPF3 Antibody (NBP1-81419)

Learn more about PTMs related to BRPF3 Antibody (NBP1-81419).

Blogs on BRPF3

There are no specific blogs for BRPF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRPF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRPF3