BRN4 Antibody


Western Blot: BRN4 Antibody [NBP2-84515] - WB Suggested Anti-POU3F4 Antibody Titration: 0.3-0.5ug/ml. Positive Control: HepG2 cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

BRN4 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of human BRN4. Peptide sequence: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Protein A purified

Alternate Names for BRN4 Antibody

  • brain-specific homeobox/POU domain protein 4
  • octamer-binding transcription factor 9
  • OTF9
  • POU class 3 homeobox 4
  • POU domain, class 3, transcription factor 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Pm, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB

Publications for BRN4 Antibody (NBP2-84515) (0)

There are no publications for BRN4 Antibody (NBP2-84515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN4 Antibody (NBP2-84515) (0)

There are no reviews for BRN4 Antibody (NBP2-84515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN4 Antibody (NBP2-84515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRN4 Products

Bioinformatics Tool for BRN4 Antibody (NBP2-84515)

Discover related pathways, diseases and genes to BRN4 Antibody (NBP2-84515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN4 Antibody (NBP2-84515)

Discover more about diseases related to BRN4 Antibody (NBP2-84515).

Pathways for BRN4 Antibody (NBP2-84515)

View related products by pathway.

PTMs for BRN4 Antibody (NBP2-84515)

Learn more about PTMs related to BRN4 Antibody (NBP2-84515).

Blogs on BRN4

There are no specific blogs for BRN4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRN4 Antibody and receive a gift card or discount.


Gene Symbol POU3F4