Home » BRN4 » BRN4 Antibodies » BRN4 Antibody

BRN4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: BRN4 Antibody [NBP2-84515] - WB Suggested Anti-POU3F4 Antibody Titration: 0.3-0.5ug/ml. Positive Control: HepG2 cell lysate
Western Blot: BRN4 Antibody [NBP2-84515] - WB Suggested Anti-POU3F4 Antibody Titration: 0.3-0.5ug/ml. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BRN4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human BRN4. Peptide sequence: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
POU3F4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for BRN4 Antibody

  • brain-specific homeobox/POU domain protein 4
  • octamer-binding transcription factor 9
  • OTF9
  • POU class 3 homeobox 4
  • POU domain, class 3, transcription factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

POU3F2/OCT7
Antibody
NBP2-21585
Immunohistochemistry-Frozen: POU3F2/OCT7 Antibody [NBP2-21585] - Frozen sectioned E13.5 Rat brain. Green: Brn2 protein stained by Brn2 antibody ( diluted at 1:250. Red: beta Tubulin 3/ TUJ1, a mature neuron marker, stained by beta Tubulin 3/ TUJ1 antibody [1710] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody [NBP2-21585] - Mouse brain. Brn2 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: POU3F2/OCT7 Antibody [NBP2-21585] - Rat brain. Brn2 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Pm, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
POU3F3 Antibody
NBP1-49872
Western Blot: POU3F3 Antibody [NBP1-49872] - Staining of Mouse Spinal Cord (A) and Brain (B) lysate (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: POU3F3 Antibody [NBP1-49872] - Immunofluorescence analysis of paraformaldehyde fixed Neuro-2a cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear staining. Actin filaments were stained with phalloidin (red) and the nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: POU3F3 Antibody [NBP1-49872] - Flow cytometric analysis of paraformaldehyde fixed Neuro-2a cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(5 Publications)
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
OCT6 Antibody
NBP3-13349
Western Blot: OCT6 Antibody [NBP3-13349] - Mouse tissue extract (50 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with OCT6 antibody (NBP3-13349) diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunohistochemistry-Paraffin: OCT6 Antibody [NBP3-13349] - OCT6 antibody detects OCT6 protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded mouse E10.5 embryo. Green: OCT6 stained by OCT6 antibody (NBP3-13349) diluted at 1:500. Red: SOX2, a nucleus marker, stained by SOX2 antibody [GT1352] (NBP2-19306) diluted at 1:250. Blue: Fluoroshield with DAPI. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: OCT6 Antibody [NBP3-13349] - OCT6 antibody detects OCT6 protein at nucleus by immunofluorescent analysis. Sample: A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: OCT6 stained by OCT6 antibody (NBP3-13349) diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:100. Scale bar= 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Connexin 26/GJB2
Antibody - BSA Free
NBP2-41304
Western Blot: Connexin 26/GJB2 Antibody [NBP2-41304] - Analysis of Connexin 26/GJB2 in human colon tissue lysate with Connexin 26/GJB2 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: Connexin 26/GJB2 Antibody [NBP2-41304] - Cx26 distribution at level of the cardiomyocyte cytoplasm. Confocal laser scanning microscopy: representative images of rat and pig heart sections. Double immunofluorescence analysis for Cx26 (red) and Cx43 (green) show a distinct cell localization of the two Cxs. (a) Three dimensional picture of the maximum intensity projection of the raw images of longitudinal rat heart section treated with R(alpha)Cx26-cl and M(alpha)Cx43. Scale bar: 20um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.
Immunohistochemistry: Connexin 26/GJB2 Antibody [NBP2-41304] - Positive and negative tissue controls for Cx26. Representative images of immunohistochemical analysis for Cx26 on rat liver and skeletal muscle sections by R(alpha)Cx26-cl antibody. Cx26 positive brown punctate staining of hepatocyte plasma membrane (arrows) and cytoplasm (arrowheads) is shown in liver. By contrast, Cx26 staining is absent in skeletal muscle. Negative controls are showen in the squares. Scale bars: 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.
(3 Publications)
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western blot shows lysates of beta TC‑6 mouse beta cell insulinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDX‑1/IPF1 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
PDX‑1/IPF1 was detected in immersion fixed BG01V human embryonic stem cells differentiated into pancreatic progenitor cells using Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL003) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Simple Western lane view shows lysates of beta TC‑6 mouse beta cell insulinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PDX‑1/IPF1 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human PDX‑1/IPF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2419) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(3 Reviews)
(33 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
TBX1 Antibody
(OTI1C2)
NBP2-46076
Western Blot: TBX1 Antibody (OTI1C2) [NBP2-46076] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TBX1.
Immunohistochemistry-Paraffin: TBX1 Antibody (OTI1C2) [NBP2-46076] - Analysis of Human lymph node tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Neurogenin-3
Antibody [Unconjugate
AF3444
Western blot shows lysates of human placenta and prostate tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Neurogenin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3444) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurogenin‑3 at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(10 Publications)
Species: Hu
Applications: IHC, WB
Connexin 31/GJB3
Antibody (3B4-1B3)
H00002707-M01
Western Blot: Connexin 31/GJB3 Antibody (3B4-1B3) [H00002707-M01] - Analysis of GJB3 expression in transfected 293T cell line by GJB3 monoclonal antibody (M01), clone 3B4-1B3.Lane 1: GJB3 transfected lysate(31 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Connexin 31/GJB3 Antibody (3B4-1B3) [H00002707-M01] - Analysis of monoclonal antibody to GJB3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Connexin 31/GJB3 Antibody (3B4-1B3) [H00002707-M01] - Detection limit for recombinant GST tagged GJB3 is approximately 0.3ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
OCT1 Antibody
NBP2-24677
Immunocytochemistry/Immunofluorescence: OCT1 Antibody [NBP2-24677] - NTERA2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-OCT1 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: OCT1 Antibody [NBP2-24677] - Analysis of OCT-1 in formalin-fixed, paraffin-embedded human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Western Blot: OCT1 Antibody [NBP2-24677] - Western blot analysis of OCT-1 in human HL60 cell lysate using NBP2-24677 at 4 ug/ml.
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Pax6 Antibody
NB300-750
Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract
Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NB300-750] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a PAX6 polyclonal antibody at a dilution of 1:400 for 30 minutes at room temperature. F-Actin (red) was stained with DyLight 554 Phalloidin were stained with Hoechst 33342 dye.
Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract
(4 Reviews)
(5 Publications)
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
CHM Antibody
NBP1-84954
Immunohistochemistry-Paraffin: CHM Antibody [NBP1-84954] - Staining of human cerebellum shows strong positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: CHM Antibody [NBP1-84954] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CHM Antibody [NBP1-84954] - Staining of human cerebral cortex shows moderate positivity in neurons.
Species: Hu
Applications: IHC, IHC-P
PRPS1 Antibody
NBP2-13813
Immunocytochemistry/Immunofluorescence: PRPS1 Antibody [NBP2-13813] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRPS1 Antibody [NBP2-13813] - Staining of human endometrium shows moderate nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: PRPS1 Antibody [NBP2-13813] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Flow cytometric analysis of paraformaldehyde fixed U2OS cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry-Paraffin: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Staining of paraffin embedded Human Pancreas with antibody at 3 ug/mL. Microwaved antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Immunocytochemistry/Immunofluorescence: Pancreatic Polypeptide/PP Antibody [NB100-1793] - Histologic comparison of wild type and Seriola dumerili mouse pancreata. Seriola dumerili Ins2 mice (bottom) have normal islet morphology and cyto-architecture compared to littermates with endogenous mouse Ins 1 and Ins 2 (top); pancreatic polypeptide (green; B,E). Scale bar: 100 um. Image collected and cropped by CiteAb from the following publication (www.nature.com/articles/s41598-019-40768-3) licensed under a CC-BY licence.
(3 Reviews)
(17 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Proprotein
Convertase 1/PCSK1 An ...
H00005122-M02
Immunocytochemistry/Immunofluorescence: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Detection limit for recombinant GST tagged PCSK1 is approximately 0.03ng/ml as a capture antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Amylin Antibody
NBP2-33680
Immunohistochemistry: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows distinct cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining in human pancreas and skeletal muscle tissues . Corresponding IAPP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
PDHX Antibody
NBP1-84079
Immunohistochemistry-Paraffin: PDHX Antibody [NBP1-84079] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: PDHX Antibody [NBP1-84079] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PDHX Antibody [NBP1-84079] - Staining in human heart muscle and pancreas tissues using anti-PDHX antibody. Corresponding PDHX RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB

Publications for BRN4 Antibody (NBP2-84515) (0)

There are no publications for BRN4 Antibody (NBP2-84515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRN4 Antibody (NBP2-84515) (0)

There are no reviews for BRN4 Antibody (NBP2-84515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRN4 Antibody (NBP2-84515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRN4 Products

Bioinformatics Tool for BRN4 Antibody (NBP2-84515)

Discover related pathways, diseases and genes to BRN4 Antibody (NBP2-84515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRN4 Antibody (NBP2-84515)

Discover more about diseases related to BRN4 Antibody (NBP2-84515).
 

Pathways for BRN4 Antibody (NBP2-84515)

View related products by pathway.

PTMs for BRN4 Antibody (NBP2-84515)

Learn more about PTMs related to BRN4 Antibody (NBP2-84515).

Blogs on BRN4

There are no specific blogs for BRN4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRN4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol POU3F4