Recombinant Human BRF2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BRF2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human BRF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BRF2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRF2 Protein

  • B-related factor 2
  • BRF-2
  • BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
  • BRFUhTFIIIB50
  • FLJ11052
  • hBRFU
  • TFIIIB50RNA polymerase III transcription initiation factor BRFU
  • transcription factor IIB- related factor, TFIIIB50
  • transcription factor IIIB 50 kDa subunit

Background

BRF2 - BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
H00055814-R01
Species: Hu
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00006621-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-58560
Species: Hu
Applications: ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-31617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BRF2 Partial Recombinant Protein (H00055290-Q01) (0)

There are no publications for BRF2 Partial Recombinant Protein (H00055290-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRF2 Partial Recombinant Protein (H00055290-Q01) (0)

There are no reviews for BRF2 Partial Recombinant Protein (H00055290-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRF2 Partial Recombinant Protein (H00055290-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRF2 Products

Bioinformatics Tool for BRF2 Partial Recombinant Protein (H00055290-Q01)

Discover related pathways, diseases and genes to BRF2 Partial Recombinant Protein (H00055290-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRF2 Partial Recombinant Protein (H00055290-Q01)

Discover more about diseases related to BRF2 Partial Recombinant Protein (H00055290-Q01).
 

Pathways for BRF2 Partial Recombinant Protein (H00055290-Q01)

View related products by pathway.

PTMs for BRF2 Partial Recombinant Protein (H00055290-Q01)

Learn more about PTMs related to BRF2 Partial Recombinant Protein (H00055290-Q01).

Blogs on BRF2

There are no specific blogs for BRF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
BRF2 Antibody
NBP2-15617

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BRF2