BRF1 Recombinant Protein Antigen

Images

 
There are currently no images for BRF1 Recombinant Protein Antigen (NBP3-17809PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BRF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRF1

Source: E. coli

Amino Acid Sequence: ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17809.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BRF1 Recombinant Protein Antigen

  • B-related factor 1
  • BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae)
  • BRF-1
  • BRFFLJ42674
  • general transcription factor IIIB, 90kD subunit
  • GTF3BTAFIII90
  • hBRFMGC105048
  • hTFIIIB90
  • TAF3B2
  • TAF3CB - related factor 1
  • TATA box binding protein (TBP)-associated factor 3C
  • TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2
  • TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2
  • TATA box-binding protein-associated factor, RNA polymerase III, subunit 2
  • TBP - associated factor, RNA polymerase III, 90kD
  • TF3B90
  • TFIIIB90FLJ43034
  • transcription factor IIIB 90 kDa subunit

Background

BRF1 encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP (-), WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP3-17176
Species: Hu
Applications: ICC/IF
H00026469-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-86906
Species: Hu
Applications: IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP2-15617
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-83654
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-77031
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-31617
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB

Publications for BRF1 Recombinant Protein Antigen (NBP3-17809PEP) (0)

There are no publications for BRF1 Recombinant Protein Antigen (NBP3-17809PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRF1 Recombinant Protein Antigen (NBP3-17809PEP) (0)

There are no reviews for BRF1 Recombinant Protein Antigen (NBP3-17809PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRF1 Recombinant Protein Antigen (NBP3-17809PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRF1 Products

Blogs on BRF1

There are no specific blogs for BRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BRF1