BRF1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

BRF1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRF1.

  Source: E. coli

  Amino Acid Sequence: PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BRF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55335.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BRF1 Recombinant Protein Antigen

• B-related factor 1
• BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae)
• BRF-1
• BRFFLJ42674
• general transcription factor IIIB, 90kD subunit
• GTF3BTAFIII90
• hBRFMGC105048
• hTFIIIB90
• TAF3B2
• TAF3CB - related factor 1
• TATA box binding protein (TBP)-associated factor 3C
• TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2
• TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2
• TATA box-binding protein-associated factor, RNA polymerase III, subunit 2
• TBP - associated factor, RNA polymerase III, 90kD
• TF3B90
• TFIIIB90FLJ43034
• transcription factor IIIB 90 kDa subunit

Background

BRF1 encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BRF1