We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Breast carcinoma amplified sequence 3 Recombinant Protein Antigen

Images

 
There are currently no images for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Breast carcinoma amplified sequence 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BCAS3.

Source: E. coli

Amino Acid Sequence: PVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCAS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14348.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Breast carcinoma amplified sequence 3 Recombinant Protein Antigen

  • BCAS4/BCAS3 fusion
  • breast carcinoma amplified sequence 3
  • breast carcinoma amplified sequence 4/3 fusion protein
  • breast carcinoma-amplified sequence 3
  • DKFZp686O1527
  • FLJ20128
  • GAOB1
  • MAAB
  • metastasis associated antigen of breast cancer
  • MGC4973
  • protein Maab1

Background

BCAS3 acts as an ERalpha coactivator in breast cancer cells. It has been demonstrated that PELP1, a newly described ERalpha coregulator, is recruited to BCAS3 chromatin and activates its expression. Analysis of the BCAS3 sequence for functional motifs and evidence from biochemical fractionation suggested that BCAS3 acts as a transcriptional coactivator. Results from chromatin immunoprecipitation, reporter assays, and expression studies further validated the coactivator function of BCAS3 for ERalpha. BCAS3 physically associated with histone H3 and histone acetyltransferase complex protein P/CAF and possessed histone acetyltransferase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77126
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-93502
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-45816
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-90063
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB6547
Species: Hu
Applications: Flow, IHC, mIF
NB100-1872
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
AF8064
Species: Hu
Applications: ICC, IHC, WB
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-31234
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB600-260
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-03396
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31862
Species: Hu
Applications: IHC,  IHC-P
NBP2-55972
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
NBP2-88806
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-14348PEP
Species: Hu
Applications: AC

Publications for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP) (0)

There are no publications for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP) (0)

There are no reviews for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Breast carcinoma amplified sequence 3 Products

Research Areas for Breast carcinoma amplified sequence 3 Protein (NBP2-14348PEP)

Find related products by research area.

Blogs on Breast carcinoma amplified sequence 3

There are no specific blogs for Breast carcinoma amplified sequence 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Breast carcinoma amplified sequence 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAS3