BPIFB3 Antibody

Images

 
Immunohistochemistry-Paraffin: BPIFB3 Antibody [NBP2-14554] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BPIFB3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSLGALGSVEFSLATLPLISNQYIELDINPIVKSVAGDIIDFPKSRAPAK VPPKKDHTSQVMVPLYLFNTTFGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BPIFB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BPIFB3 Protein (NBP2-14554PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BPIFB3 Antibody

  • BPIFB3 BPI fold containing family B, member 3
  • C20orf185
  • dJ726C3.4
  • LPLUNC3
  • RYA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00149954-P01
Species: Hu
BPI
7468-BP
Species: Hu
AF4274
Species: Mu
Applications: WB, IHC
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB2388
Species: Hu
Applications: WB, IHC
AF5659
Species: Hu
Applications: WB
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56848
Species: Hu
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37489
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
870-LP/CF
Species: Hu
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BPIFB3 Antibody (NBP2-14554) (0)

There are no publications for BPIFB3 Antibody (NBP2-14554).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPIFB3 Antibody (NBP2-14554) (0)

There are no reviews for BPIFB3 Antibody (NBP2-14554). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BPIFB3 Antibody (NBP2-14554) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPIFB3 Products

BPIFB3 NBP2-14554

Bioinformatics Tool for BPIFB3 Antibody (NBP2-14554)

Discover related pathways, diseases and genes to BPIFB3 Antibody (NBP2-14554). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on BPIFB3

There are no specific blogs for BPIFB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPIFB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPIFB3