Recombinant Human BNIP2 Protein (H00000663-P01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BNIP2 Protein Summary

Description
BNIP2 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ
Protein/Peptide Type
Recombinant Protein
Gene
BNIP2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00000663-P01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BNIP2 Protein

  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
  • BCL2/adenovirus E1B 19kDa interacting protein 2
  • BCL2/adenovirus E1B 19kD-interacting protein 2
  • BNIP-2
  • NIP2

Background

This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89335
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
H00149428-M03
Species: Hu
Applications: WB, ELISA
AF2429
Species: Mu
Applications: WB, IHC
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46580
Species: Hu
Applications: WB, IHC
NBP2-57680
Species: Hu
Applications: ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, ICC
NBP2-33988
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BNIP2 Recombinant Protein (H00000663-P01)(1)

Reviews for BNIP2 Recombinant Protein (H00000663-P01) (0)

There are no reviews for BNIP2 Recombinant Protein (H00000663-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNIP2 Recombinant Protein (H00000663-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human BNIP2 Protein Products

Related Products by Gene

Bioinformatics Tool for BNIP2 Recombinant Protein (H00000663-P01)

Discover related pathways, diseases and genes to BNIP2 Recombinant Protein (H00000663-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIP2 Recombinant Protein (H00000663-P01)

Discover more about diseases related to BNIP2 Recombinant Protein (H00000663-P01).
 

Pathways for BNIP2 Recombinant Protein (H00000663-P01)

View related products by pathway.

PTMs for BNIP2 Recombinant Protein (H00000663-P01)

Learn more about PTMs related to BNIP2 Recombinant Protein (H00000663-P01).
 

Research Areas for BNIP2 Recombinant Protein (H00000663-P01)

Find related products by research area.

Blogs on BNIP2

There are no specific blogs for BNIP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BNIP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIP2

Customers Who Bought This Also Bought

Bcl-2 Antibody
NB100-56098
Bcl-2 Antibody
NB100-56098
Bcl-2 Antibody
NB100-56098
BNIP2 Antibody
NBP1-88559
BNIP2 Antibody
NBP1-88559
BNIP2 Antibody
NBP1-88559
BID Antibody
NB100-56106
BID Antibody
NB100-56106
BID Antibody
NB100-56106