Biliverdin Reductase A/BLVRA Antibody

Images

 
Western Blot: Biliverdin Reductase A/BLVRA Antibody [NBP1-90757] - Analysis in human cell line RPMI-8226.
Immunohistochemistry-Paraffin: Biliverdin Reductase A/BLVRA Antibody [NBP1-90757] - Staining of human spleen shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Biliverdin Reductase A/BLVRA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL
Specificity
Specificity of human Biliverdin Reductase A/BLVRA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BLVRA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Biliverdin Reductase A/BLVRA Knockout 293T Cell Lysate
Control Peptide
Biliverdin Reductase A/BLVRA Protein (NBP1-90757PEP)
Publications
Read Publication using
NBP1-90757 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%). Human reactivity reported in scientific literature (PMID: 25389781).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Biliverdin Reductase A/BLVRA Antibody

  • Biliverdin Reductase A
  • Biliverdin-IX alpha-reductase
  • BLVR
  • BLVRA
  • BVR A
  • BVR
  • BVRA
  • EC 1.3.1.24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP2-75626
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90757
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757) (0)

There are no reviews for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Biliverdin Reductase A/BLVRA Products

Bioinformatics Tool for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757)

Discover related pathways, diseases and genes to Biliverdin Reductase A/BLVRA Antibody (NBP1-90757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757)

Discover more about diseases related to Biliverdin Reductase A/BLVRA Antibody (NBP1-90757).
 

Pathways for Biliverdin Reductase A/BLVRA Antibody (NBP1-90757)

View related products by pathway.

Blogs on Biliverdin Reductase A/BLVRA

There are no specific blogs for Biliverdin Reductase A/BLVRA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biliverdin Reductase A/BLVRA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLVRA