Biliverdin Reductase A/BLVRA Antibody

Images

 
Western Blot: Biliverdin Reductase A/BLVRA Antibody [H00000644-B01P] - Analysis of BLVRA expression in human liver.
Immunocytochemistry/ Immunofluorescence: Biliverdin Reductase A/BLVRA Antibody [H00000644-B01P] - Analysis of purified antibody to BLVRA on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Biliverdin Reductase A/BLVRA Antibody [H00000644-B01P] - Analysis of BLVRA expression in HeLa.
Western Blot: Biliverdin Reductase A/BLVRA Antibody [H00000644-B01P] - Analysis of BLVRA expression in transfected 293T cell line by BLVRA polyclonal antibody. Lane 1: BLVRA transfected lysate(32.56 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Biliverdin Reductase A/BLVRA Antibody Summary

Immunogen
BLVRA (NP_000703.2, 1 a.a. - 296 a.a.) full-length human protein. MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Specificity
BLVRA - biliverdin reductase A,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BLVRA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Biliverdin Reductase A/BLVRA Antibody

  • Biliverdin Reductase A
  • Biliverdin-IX alpha-reductase
  • BLVR
  • BLVRA
  • BVR A
  • BVR
  • BVRA
  • EC 1.3.1.24

Background

Biliverdin reductases, such as BLVRA (EC 1.3.1.24), catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH (Komuro et al., 1996 [PubMed 8950184]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P) (0)

There are no publications for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P) (0)

There are no reviews for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Biliverdin Reductase A/BLVRA Products

Bioinformatics Tool for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P)

Discover related pathways, diseases and genes to Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P)

Discover more about diseases related to Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P).
 

Pathways for Biliverdin Reductase A/BLVRA Antibody (H00000644-B01P)

View related products by pathway.

Blogs on Biliverdin Reductase A/BLVRA

There are no specific blogs for Biliverdin Reductase A/BLVRA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Biliverdin Reductase A/BLVRA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BLVRA
Entrez
Uniprot