BHLHB5 Antibody

Immunohistochemistry-Paraffin: BHLHB5 Antibody [NBP2-39085] - Staining of human liver.

Immunohistochemistry: BHLHB5 Antibody [NBP2-39085] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.

Immunohistochemistry-Paraffin: BHLHB5 Antibody [NBP2-39085] - Staining of human cerebellum, colon, liver and testis using Anti-BHLHE22 antibody NBP2-39085 (A) shows similar protein distribution across tissues to independent antibody NBP2-39016 (B).

Immunohistochemistry-Paraffin: BHLHB5 Antibody [NBP2-39085] - Staining of human cerebellum.

Immunohistochemistry-Paraffin: BHLHB5 Antibody [NBP2-39085] - Staining of human testis.

Immunohistochemistry-Paraffin: BHLHB5 Antibody [NBP2-39085] - Staining of human colon.

Product Discontinued

BHLHB5 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGV
• Predicted Species: Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BHLHE22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BHLHB5 Protein (NBP2-39085PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BHLHB5 Antibody

• Basic Helix-Loop-Helix Domain Containing, Class B, 5
• basic helix-loop-helix family, member e22
• Beta3
• BHLHE22
• CAGL85
• Class B Basic Helix-Loop-Helix Protein 5
• Class E Basic Helix-Loop-Helix Protein 22
• TNRC20
• Trinucleotide Repeat Containing 20
• Trinucleotide Repeat-Containing Gene 20 Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BHLHE22
• Uniprot:
  • Q8NFJ8(Human)