beta-2 Adrenergic R/ADRB2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADRB2. Source: E. coli
Amino Acid Sequence: CRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ADRB2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90227. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for beta-2 Adrenergic R/ADRB2 Recombinant Protein Antigen
Background
The beta-2 adrenoceptor (ADRB2) is an Adrenergic Receptor expressed in smooth muscle and metabolic tissues. Activation of this receptor induces a decrease in gastrointestinal motility, bronchodilation, vasodilation in skeletal and cardiac muscle, and glycogenolysis in liver. The beta-2 adrenoceptor is also a major lipolytic receptor in human fat cells and may be involved in obesity. Agonists of ADRB2 are most widely used for the treatment of asthma. In complex with beta-arrestin-1 and c-src, the beta-2 adrenergic receptor activates MAP kinases ERK1(MAPK3) and ERK2 (MAPK1). Expression of the beta-2 adrenoceptor has been reported in adipose, blood, brain, heart, lung, nose, pancreas, skeletal muscle, skin, and vessel. ESTs have been isolated from breast, liver, liver/spleen, placenta, and uterus libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, In vitro, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: AC
Publications for beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP) (0)
There are no publications for beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP) (0)
There are no reviews for beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP) (0)
Additional beta-2 Adrenergic R/ADRB2 Products
Research Areas for beta-2 Adrenergic R/ADRB2 Protein (NBP1-90227PEP)
Find related products by research area.
|
Blogs on beta-2 Adrenergic R/ADRB2