Beta 2 Adaptin Antibody [Alexa Fluor® 532]

Images

 
There are currently no images for Beta 2 Adaptin Antibody (NBP3-35911AF532).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Alexa Fluor 532

Order Details

Beta 2 Adaptin Antibody [Alexa Fluor® 532] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 752-951 of human Beta 2 Adaptin (NP_001025177.1).

Sequence:
MEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP2B1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Beta 2 Adaptin Antibody [Alexa Fluor® 532]

  • Adapter-related protein complex 2 beta subunit
  • Adaptor protein complex AP-2 subunit beta
  • adaptor-related protein complex 2, beta 1 subunit
  • ADTB2adaptin, beta 2 (beta)
  • AP105B
  • AP2-BETA
  • beta-2-adaptin
  • beta-adaptin
  • CLAPB1AP-2 complex subunit beta
  • Clathrin assembly protein complex 2 beta large chain
  • clathrin-associated/assembly/adaptor protein, large, beta 1
  • DKFZp781K0743
  • Plasma membrane adaptor HA2/AP2 adaptin beta subunit

Background

Clathrin-mediated endocytosis is the pathway by which many receptors for nutrients and hormones are internalized to be recycled or down-regulated. During formation of clathrin coated membranes, clathrin co-assembles with heterotetrameric molecules known as assembly polypeptides (APs) or adaptors which form a layer of protein coat between the clathrin lattice and the membrane. There are two characterized adaptors AP1 and AP2. AP1 is associated with clathrin coated vesicles at the trans-Golgi network and AP2 is associated with the endocytic clathrin coated vesicles at the plasma membrane and has been shown to specifically interact with Shc and EGF receptor. AP2 is composed of four subunits, two separate 100 kDa gene products with similar domain structures (alpha and beta adaptin) and a 50 and 17 kDa subunit. There are two alpha-adaptin genes, alpha A and alpha C which have a tissue specific pattern of expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15578
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-00834
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-04017
Species: Hu
Applications: IP, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Beta 2 Adaptin Antibody (NBP3-35911AF532) (0)

There are no publications for Beta 2 Adaptin Antibody (NBP3-35911AF532).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Beta 2 Adaptin Antibody (NBP3-35911AF532) (0)

There are no reviews for Beta 2 Adaptin Antibody (NBP3-35911AF532). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Beta 2 Adaptin Antibody (NBP3-35911AF532) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Beta 2 Adaptin Antibody [Alexa Fluor® 532] and receive a gift card or discount.

Bioinformatics

Gene Symbol AP2B1