BAZ2A Antibody

Immunocytochemistry/Immunofluorescence: BAZ2A Antibody [NBP2-55854] - Staining of human cell line SiHa shows localization to nuclear speckles. Antibody staining is shown in green.

Product Discontinued

BAZ2A Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLEVPLTASVTSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGDVMRRRIATPEEVRLPLQHGWRREVRIKKGSHR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAZ2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BAZ2A Antibody

• BAZ2A
• bromodomain adjacent to zinc finger domain protein 2A
• bromodomain adjacent to zinc finger domain, 2A
• DKFZp781B109
• FLJ45876
• hWALp3
• KIAA0314
• KIAA0314FLJ13768
• Tip5
• TIP5FLJ13780
• Transcription termination factor I-interacting protein 5
• TTF-I interacting peptide 5
• TTF-I-interacting protein 5
• WALp3

Background

Essential component of the NoRC (nucleolar remodeling complex) complex, a complex that mediates silencing of a fraction of rDNA by recruiting histone-modifying enzymes and DNA methyltransferases, leading to heterochromatin formation and transcriptional silencing. In the complex, it plays a central role by being recruited to rDNA and by targeting chromatin modifying enzymes such as HDAC1, leading to repress RNA polymerase I transcription. Recruited to rDNA via its interaction with TTF1 and its ability to recognize and bind histone H4 acetylated on 'Lys-16' (H4K16ac), leading to deacetylation of H4K5ac, H4K8ac, H4K12ac but not H4K16ac. Specifically binds pRNAs, 150-250 nucleotide RNAs that are complementary in sequence to the rDNA promoter; pRNA-binding is required for heterochromatin formation and rDNA silencing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAZ2A