Recombinant Human BARHL1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BARHL1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 55-154 of Human BARHL1

Source: Wheat Germ

Amino Acid Sequence: GRDCLETGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
BARHL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BARHL1 Protein

  • BarH (Drosophila)-like 1
  • barH-like 1 homeobox protein
  • BarH-like homeobox 1

Background

BARHL1 - BarH-like 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005459-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-31318
Species: Mu
Applications: IHC-P
H00343472-Q01
Species: Hu
NBP1-31318
Species: Mu
Applications: IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NLS2656
Species: Hu
Applications: WB, IHC, IHC-P, ICC
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-57015
Species: Hu
Applications: WB
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
H00056751-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BARHL1 Partial Recombinant Protein (H00056751-Q01) (0)

There are no publications for BARHL1 Partial Recombinant Protein (H00056751-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BARHL1 Partial Recombinant Protein (H00056751-Q01) (0)

There are no reviews for BARHL1 Partial Recombinant Protein (H00056751-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BARHL1 Partial Recombinant Protein (H00056751-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BARHL1 Partial Recombinant Protein (H00056751-Q01)

Discover related pathways, diseases and genes to BARHL1 Partial Recombinant Protein (H00056751-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARHL1 Partial Recombinant Protein (H00056751-Q01)

Discover more about diseases related to BARHL1 Partial Recombinant Protein (H00056751-Q01).
 

Pathways for BARHL1 Partial Recombinant Protein (H00056751-Q01)

View related products by pathway.

PTMs for BARHL1 Partial Recombinant Protein (H00056751-Q01)

Learn more about PTMs related to BARHL1 Partial Recombinant Protein (H00056751-Q01).

Blogs on BARHL1

There are no specific blogs for BARHL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BARHL1 Antibody
NBP1-86513

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BARHL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BARHL1