BAIAP2 Recombinant Protein Antigen

Images

 
There are currently no images for BAIAP2 Protein (NBP1-88710PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BAIAP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAIAP2.

Source: E. coli

Amino Acid Sequence: AYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BAIAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88710.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BAIAP2 Recombinant Protein Antigen

  • BAI1-associated protein 2IRS-58
  • BAI-associated protein 2
  • BAP2
  • brain-specific angiogenesis inhibitor 1-associated protein 2
  • Fas ligand-associated factor 3
  • FLAF3
  • Insulin receptor substrate p53
  • Insulin receptor substrate p53/p58
  • Insulin receptor substrate protein of 53 kDa
  • IRSP53
  • IRSp53/58
  • Protein BAP2

Background

BAIAP2 is encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This interaction at the cytoplasmic membrane is crucial to the function of this protein, which may be involved in neuronal growth-cone guidance. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. Alternative splicing of the 3'-end of this gene results in three products of undetermined function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89528
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF5514
Species: Hu, Mu
Applications: WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-819
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-59845
Species: Hu
Applications: IHC,  IHC-P, IP (-), WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for BAIAP2 Protein (NBP1-88710PEP) (0)

There are no publications for BAIAP2 Protein (NBP1-88710PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAIAP2 Protein (NBP1-88710PEP) (0)

There are no reviews for BAIAP2 Protein (NBP1-88710PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAIAP2 Protein (NBP1-88710PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAIAP2 Products

Research Areas for BAIAP2 Protein (NBP1-88710PEP)

Find related products by research area.

Blogs on BAIAP2

There are no specific blogs for BAIAP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAIAP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BAIAP2