Recombinant Human B4GALT6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human B4GALT6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-343 of Human B4GALT6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
B4GALT6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human B4GALT6 Protein

  • B4Gal-T6
  • beta-1,4-galactosyltransferase 6
  • Beta-1,4-GalTase 6
  • beta4Gal-T6
  • beta4GalT-VI
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6
  • UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6

Background

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene is a lactosylceramide synthase important for glycolipid biosynthesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
AF1267
Species: Hu
Applications: WB, IP, Neut
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-611
Species: Hu
Applications: WB, IP
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for B4GALT6 Recombinant Protein (H00009331-P01) (0)

There are no publications for B4GALT6 Recombinant Protein (H00009331-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALT6 Recombinant Protein (H00009331-P01) (0)

There are no reviews for B4GALT6 Recombinant Protein (H00009331-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALT6 Recombinant Protein (H00009331-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B4GALT6 Products

Bioinformatics Tool for B4GALT6 Recombinant Protein (H00009331-P01)

Discover related pathways, diseases and genes to B4GALT6 Recombinant Protein (H00009331-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALT6 Recombinant Protein (H00009331-P01)

Discover more about diseases related to B4GALT6 Recombinant Protein (H00009331-P01).
 

Pathways for B4GALT6 Recombinant Protein (H00009331-P01)

View related products by pathway.

PTMs for B4GALT6 Recombinant Protein (H00009331-P01)

Learn more about PTMs related to B4GALT6 Recombinant Protein (H00009331-P01).
 

Research Areas for B4GALT6 Recombinant Protein (H00009331-P01)

Find related products by research area.

Blogs on B4GALT6

There are no specific blogs for B4GALT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

B4GALT6 Antibody
NBP2-37967

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human B4GALT6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT6