Recombinant Human Axin-1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Axin-1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 643-740 of Human Axin-1

Source: Wheat Germ

Amino Acid Sequence: ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AXIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Axin-1 Protein

  • axin 1
  • Axin1
  • Axin-1
  • AXINaxis inhibitor 1
  • Axis inhibition protein 1
  • fused, mouse, homolog of
  • hAxin
  • MGC52315

Background

AXIN1 - axin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for Axin-1 Partial Recombinant Protein (H00008312-Q02) (0)

There are no publications for Axin-1 Partial Recombinant Protein (H00008312-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axin-1 Partial Recombinant Protein (H00008312-Q02) (0)

There are no reviews for Axin-1 Partial Recombinant Protein (H00008312-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Axin-1 Partial Recombinant Protein (H00008312-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Axin-1 Partial Recombinant Protein (H00008312-Q02)

Discover related pathways, diseases and genes to Axin-1 Partial Recombinant Protein (H00008312-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axin-1 Partial Recombinant Protein (H00008312-Q02)

Discover more about diseases related to Axin-1 Partial Recombinant Protein (H00008312-Q02).
 

Pathways for Axin-1 Partial Recombinant Protein (H00008312-Q02)

View related products by pathway.

PTMs for Axin-1 Partial Recombinant Protein (H00008312-Q02)

Learn more about PTMs related to Axin-1 Partial Recombinant Protein (H00008312-Q02).
 

Research Areas for Axin-1 Partial Recombinant Protein (H00008312-Q02)

Find related products by research area.

Blogs on Axin-1

There are no specific blogs for Axin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Axin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AXIN1
Entrez