AVL9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AVL9 Antibody [NBP2-14337] - Staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: AVL9 Antibody [NBP2-14337] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunocytochemistry/ Immunofluorescence: AVL9 Antibody [NBP2-14337] - Staining of Saos2 cells. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AVL9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVG QSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AVL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AVL9 Protein (NBP2-14337PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-14337 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AVL9 Antibody

  • AVL9 homolog (S. cerevisiase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-56218
Species: Hu
Applications: ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57529
Species: Hu
Applications: WB, ICC/IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AVL9 Antibody (NBP2-14337) (0)

There are no publications for AVL9 Antibody (NBP2-14337).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for AVL9 Antibody (NBP2-14337) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IF.

Reviews using NBP2-14337:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence AVL9 NBP2-14337
Enlarge
reviewed by:
Anonymous
IF Human 03/28/2014
View

Summary

ApplicationImmunofluorescence
Sample TestedSaos2 Cells
SpeciesHuman
Lotab175108
CommentsOverall antibody worked great, excellent signal-to-background

Blocking

Blocking DetailsBlocked in TBST at room temperature for 1 hour

Primary Anitbody

Dilution Ratio1:1000 in TBST, 1 hour at room temperature

Secondary Antibody

Secondary Descriptionanti-Rabbit Alexa94
Secondary Manufacturer Cat#ab150092
Secondary Concentration1:1000 in TBST

Details

Detection NotesOpera high-throughput confocal microscope, 300ms exposure
Fixation DetailsFixed with 4% paraformaldehyde in PBS at room temperature for 20 minutes, permeabilized with TBST at room temperature for 1h
Wash DescriptionTBST, 3 washes at 5 minutes each

Comments

CommentsOverall antibody worked great, excellent signal-to-background

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AVL9 Antibody (NBP2-14337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AVL9 Products

AVL9 NBP2-14337

Bioinformatics Tool for AVL9 Antibody (NBP2-14337)

Discover related pathways, diseases and genes to AVL9 Antibody (NBP2-14337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for AVL9 Antibody (NBP2-14337)

View related products by pathway.

Blogs on AVL9

There are no specific blogs for AVL9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
03/28/2014
Application: IF
Species: Human

Bioinformatics

Gene Symbol AVL9