ATP6V1E1 Antibody (4E11.)

Images

 
Western Blot: ATP6V1E1 Antibody (4E11) [H00000529-M02] - Analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 monoclonal antibody (M02), clone 4E11.Lane 1: ATP6V1E1 transfected lysate(26.1 KDa).Lane ...read more
Immunocytochemistry/ Immunofluorescence: ATP6V1E1 Antibody (4E11) [H00000529-M02] - Analysis of monoclonal antibody to ATP6V1E1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: ATP6V1E1 Antibody (4E11) [H00000529-M02] - Detection limit for recombinant GST tagged ATP6V1E1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4E11.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATP6V1E1 Antibody (4E11.) Summary

Immunogen
ATP6V1E1 (AAH04443, 1 a.a. - 226 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP6V1E1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V1E1 Antibody (4E11.)

  • ATP6E2ATP6V1E
  • ATP6E31kDa subunit
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD
  • ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1
  • ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
  • H+-transporting ATP synthase chain E, vacuolar
  • p31
  • Vacuolar proton pump subunit E 1
  • V-ATPase 31 kDa subunit
  • V-ATPase subunit E 1
  • V-ATPase, subunit E
  • Vma4
  • V-type proton ATPase subunit E 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4185
Species: Hu
Applications: ICC
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7250
Species: Hu
Applications: IHC
NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF

Publications for ATP6V1E1 Antibody (H00000529-M02) (0)

There are no publications for ATP6V1E1 Antibody (H00000529-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1E1 Antibody (H00000529-M02) (0)

There are no reviews for ATP6V1E1 Antibody (H00000529-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATP6V1E1 Antibody (H00000529-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1E1 Products

Bioinformatics Tool for ATP6V1E1 Antibody (H00000529-M02)

Discover related pathways, diseases and genes to ATP6V1E1 Antibody (H00000529-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1E1 Antibody (H00000529-M02)

Discover more about diseases related to ATP6V1E1 Antibody (H00000529-M02).
 

Pathways for ATP6V1E1 Antibody (H00000529-M02)

View related products by pathway.

Blogs on ATP6V1E1

There are no specific blogs for ATP6V1E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1E1 Antibody (4E11.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1E1
Uniprot