ATP6V0A2 Recombinant Protein Antigen

Images

 
There are currently no images for ATP6V0A2 Recombinant Protein Antigen (NBP1-91690PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ATP6V0A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V0A2.

Source: E. coli

Amino Acid Sequence: EVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V0A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91690.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP6V0A2 Recombinant Protein Antigen

  • A2
  • ARCL
  • ATP6A2
  • ATP6N1D
  • ATP6V0
  • ATPase, H+ transporting, lysosomal V0 subunit a isoform 2
  • ATPase, H+ transporting, lysosomal V0 subunit a2
  • infantile malignant osteopetrosis
  • J6B7
  • Lysosomal H(+)-transporting ATPase V0 subunit a2
  • regeneration and tolerance factor
  • RTF
  • STV1
  • TJ6A2V-ATPase
  • TJ6M
  • TJ6S
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2
  • vacuolar proton translocating ATPase 116 kDa subunit a
  • V-ATPase 116 kDa isoform a2
  • v-ATPase 116 kDa
  • VPH1
  • V-type proton ATPase 116 kDa subunit a isoform 2
  • v-type proton ATPase 116 kDa subunit a
  • WSS

Background

The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain; ATP6V0A2 is a component of the V(0) domain (Smith et al., 2003 [PubMed 14580332]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-44634
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC,  IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-06290
Species: Hu
Applications: IHC,  IHC-P
AF1936
Species: Hu
Applications: IP, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for ATP6V0A2 Recombinant Protein Antigen (NBP1-91690PEP) (0)

There are no publications for ATP6V0A2 Recombinant Protein Antigen (NBP1-91690PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V0A2 Recombinant Protein Antigen (NBP1-91690PEP) (0)

There are no reviews for ATP6V0A2 Recombinant Protein Antigen (NBP1-91690PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP6V0A2 Recombinant Protein Antigen (NBP1-91690PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V0A2 Products

Blogs on ATP6V0A2

There are no specific blogs for ATP6V0A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP6V0A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V0A2