ATOH7 Antibody

Immunocytochemistry/Immunofluorescence: ATOH7 Antibody [NBP1-88639] - Differential Notch-mediated regulation of Atoh7 transcription. Colocalization of transient mCherry transgenic expression, driven by a 2.4 kb mouse Atoh7 enhancer, to endogenous Atoh7 protein in the E13.5 retina (White arrows point to colabeled cells). Both cytoplasmic and nuclear Cherry expression are seen, presumably due to the inefficiency of a synthetic nuclear localization sequence and reporter antibody sensitivity, which detected both nascent Cherry protein in the cytoplasm and its accumulation in the nucleus. Scale bar = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-28420-y), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of mouse embryo E14 shows moderate to strong nuclear positivity in a subset of cells in the developing eye retina.

Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human eye shows weak to moderate nuclear positivity in the outer nuclear layer of retina.

Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

ATOH7 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATOH7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID: 29225067). Use in ICC/IF reported in scientific literature (PMID: 32023475).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATOH7 Antibody

• ATH5
• atonal homolog 7 (Drosophila)
• BHLHA13
• bHLHa13protein atonal homolog 7
• Class A basic helix-loop-helix protein 13
• hATH5
• Helix-loop-helix protein hATH-5
• Math5

Background

ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 (PubMed11889557)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATOH7 Antibody (NBP1-88639)(9)

Publications using NBP1-88639

• Brodie-Kommit J, Clark BS, Shi Q et al. Atoh7-independent specification of retinal ganglion cell identity Science advances 2021-03-01 [PMID: 33712461]
• Wu F, Bard JE, Kann J et al. Single cell transcriptomics reveals lineage trajectory of retinal ganglion cells in wild-type and Atoh7-null retinas Nature communications 2021-03-05 [PMID: 33674582] (ICC/IF, Mouse)
• Lu Y, Shiau F, Yi W et al. Single-Cell Analysis of Human Retina Identifies Evolutionarily Conserved and Species-Specific Mechanisms Controlling Development Dev. Cell 2020-05-18 [PMID: 32386599]
• Sridhar A, Hoshino A, Finkbeiner CR et al. Single-Cell Transcriptomic Comparison of Human Fetal Retina, hPSC-Derived Retinal Organoids, and Long-Term Retinal Cultures Cell Rep 2020-02-04 [PMID: 32023475] (ICC/IF, Human)
• Bosze B, Moon MS, Kageyama R, Brown NL Simultaneous requirements for Hes1 in retinal neurogenesis and optic cup-stalk boundary maintenance J. Neurosci. 2020-01-13 [PMID: 31949107] (ICC/IF, Mouse)
• Miltner AM, Mercado-Ayon Y, Cheema SK et al. A Novel Reporter Mouse Uncovers Endogenous Brn3b Expression Int J Mol Sci 2019-06-14 [PMID: 31197108] (IF/IHC, Mouse)
• Kaufman ML, Park KU, Goodson NB et al. Transcriptional profiling of murine retinas undergoing semi-synchronous cone photoreceptor differentiation Dev. Biol. 2019-06-01 [PMID: 31163126] (IF/IHC, Mouse)
• Miesfeld JB, Moon MS, Riesenberg AN et al. Rbpj direct regulation of Atoh7 transcription in the embryonic mouse retina. Sci Rep. 2018-07-05 [PMID: 29977079] (IF/IHC, Mouse)
• Miesfeld JB, Glaser T, Brown NL. The dynamics of native Atoh7 protein expression during mouse retinal histogenesis, revealed with a new antibody. Gene Expr. Patterns 2017-12-07 [PMID: 29225067] (WB, Mouse, Human)

Review for ATOH7 Antibody (NBP1-88639) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IF Mouse 02/24/2020

Summary

• Application: Immunofluorescence
• Sample Tested: mouse retina
• Species: Mouse
• Lot: A106752

Bioinformatics

• Gene Symbol: ATOH7