ATOH7 Antibody

Images

 
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human eye shows weak to moderate nuclear positivity in the outer nuclear layer of retina.
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of mouse embryo E14 shows moderate to strong nuclear positivity in a subset of cells in the developing eye retina.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATOH7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATOH7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATOH7 Antibody

  • ATH5
  • atonal homolog 7 (Drosophila)
  • BHLHA13
  • bHLHa13protein atonal homolog 7
  • Class A basic helix-loop-helix protein 13
  • hATH5
  • Helix-loop-helix protein hATH-5
  • Math5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
MAB3314
Species: Hu, Rt
Applications: IHC
AF2746
Species: Hu, Mu
Applications: WB, ICC
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-31318
Species: Mu
Applications: IHC-P
AF2567
Species: Mu
Applications: WB, IHC
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00338917-T01
Species: Hu
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for ATOH7 Antibody (NBP1-88639) (0)

There are no publications for ATOH7 Antibody (NBP1-88639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATOH7 Antibody (NBP1-88639) (0)

There are no reviews for ATOH7 Antibody (NBP1-88639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATOH7 Antibody (NBP1-88639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATOH7 Products

Bioinformatics Tool for ATOH7 Antibody (NBP1-88639)

Discover related pathways, diseases and genes to ATOH7 Antibody (NBP1-88639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATOH7 Antibody (NBP1-88639)

Discover more about diseases related to ATOH7 Antibody (NBP1-88639).
 

Pathways for ATOH7 Antibody (NBP1-88639)

View related products by pathway.

PTMs for ATOH7 Antibody (NBP1-88639)

Learn more about PTMs related to ATOH7 Antibody (NBP1-88639).

Blogs on ATOH7

There are no specific blogs for ATOH7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATOH7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATOH7