ATOH7 Antibody


Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human eye shows weak to moderate nuclear positivity in the outer nuclear layer of retina.
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of mouse embryo E14 shows moderate to strong nuclear positivity in a subset of cells in the developing eye retina.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ATOH7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Specificity of human, mouse ATOH7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western Blot reported in scientific literature (PMID: 29225067).
Read Publication using
NBP1-88639 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATOH7 Antibody

  • ATH5
  • atonal homolog 7 (Drosophila)
  • BHLHA13
  • bHLHa13protein atonal homolog 7
  • Class A basic helix-loop-helix protein 13
  • hATH5
  • Helix-loop-helix protein hATH-5
  • Math5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
Species: Hu, Rt
Applications: WB, ELISA, Single Cell Western
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Mu
Applications: IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for ATOH7 Antibody (NBP1-88639)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ATOH7 Antibody (NBP1-88639) (0)

There are no reviews for ATOH7 Antibody (NBP1-88639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATOH7 Antibody (NBP1-88639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATOH7 Products

Bioinformatics Tool for ATOH7 Antibody (NBP1-88639)

Discover related pathways, diseases and genes to ATOH7 Antibody (NBP1-88639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATOH7 Antibody (NBP1-88639)

Discover more about diseases related to ATOH7 Antibody (NBP1-88639).

Pathways for ATOH7 Antibody (NBP1-88639)

View related products by pathway.

PTMs for ATOH7 Antibody (NBP1-88639)

Learn more about PTMs related to ATOH7 Antibody (NBP1-88639).

Blogs on ATOH7

There are no specific blogs for ATOH7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATOH7 Antibody and receive a gift card or discount.


Gene Symbol ATOH7