ATOH7 Antibody Summary
| Immunogen |
ATOH7 (NP_660161.1, 1 a.a. - 152 a.a.) full-length human protein. MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT |
| Specificity |
This product is specific for Human ATOH7 purified MaxPab rabbit polyclonal antibody (D03P) [Gene ID: 220202]. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ATOH7 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
Rabbit polyclonal antibody raised against a full-length human ATOH7 protein. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ATOH7 Antibody
Background
ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 (PubMed11889557)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: IHC
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Publications for ATOH7 Antibody (H00220202-D03P) (0)
There are no publications for ATOH7 Antibody (H00220202-D03P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ATOH7 Antibody (H00220202-D03P) (0)
There are no reviews for ATOH7 Antibody (H00220202-D03P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ATOH7 Antibody (H00220202-D03P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ATOH7 Products
Blogs on ATOH7