Recombinant Human ATG13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATG13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-480 of Human ATG13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ATG13
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATG13 Protein

  • autophagy-related protein 13
  • autophagy related 13
  • KIAA0652

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB100-77279
Species: Hu, Mu
Applications: WB, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-88877
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS1720
Species: Hu
Applications: IHC-P
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
H00009776-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ATG13 Recombinant Protein (H00009776-P01) (0)

There are no publications for ATG13 Recombinant Protein (H00009776-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG13 Recombinant Protein (H00009776-P01) (0)

There are no reviews for ATG13 Recombinant Protein (H00009776-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG13 Recombinant Protein (H00009776-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG13 Products

Bioinformatics Tool for ATG13 Recombinant Protein (H00009776-P01)

Discover related pathways, diseases and genes to ATG13 Recombinant Protein (H00009776-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG13 Recombinant Protein (H00009776-P01)

Discover more about diseases related to ATG13 Recombinant Protein (H00009776-P01).
 

Pathways for ATG13 Recombinant Protein (H00009776-P01)

View related products by pathway.

PTMs for ATG13 Recombinant Protein (H00009776-P01)

Learn more about PTMs related to ATG13 Recombinant Protein (H00009776-P01).

Blogs on ATG13.

ATG11 - An important scaffolding protein in autophagosome formation and fusion
Autophagy is a cellular mechanism used to regulate cell metabolism and to recycle or degrade damaged organelles and proteins. This is accomplished through the engulfment of cargo in a double-membrane structure called the autophagosome. The autophag...  Read full blog post.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

Customers Who Bought This Also Bought

ATG5 Antibody
NB110-53818

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATG13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG13