Recombinant Human ATF6 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related ATF6 Peptides and Proteins

Order Details


    • Catalog Number
      H00022926-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ATF6 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 91-193 of Human ATF6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATF6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.07 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATF6 GST (N-Term) Protein

  • ACHM7
  • Activating transcription factor 6 alpha
  • activating transcription factor 6
  • atf6 a
  • ATF6 alpha
  • ATF6
  • ATF6A
  • ATF6-alpha
  • cAMP-dependent transcription factor ATF-6 alpha
  • cyclic AMP-dependent transcription factor ATF-6 alpha

Background

ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
AF3999
Species: Hu
Applications: KO, WB
NB100-2323
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, Simple Western, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP3-17487
Species: Hu
Applications: IHC,  IHC-P
NB100-852
Species: Hu, Mu
Applications: PEP-ELISA, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-05161
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-778
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP1-76801
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB

Publications for ATF6 Partial Recombinant Protein (H00022926-Q01) (0)

There are no publications for ATF6 Partial Recombinant Protein (H00022926-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF6 Partial Recombinant Protein (H00022926-Q01) (0)

There are no reviews for ATF6 Partial Recombinant Protein (H00022926-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF6 Partial Recombinant Protein (H00022926-Q01). (Showing 1 - 1 of 1 FAQ).

  1. We are looking for an antibody specific to ATF6 alpha that will not cross-react with ATF6 beta. Would you please help confirm if any of the following are ATF6 alpha specific antibodies: NBP1-40256, NBP1-77251, NBP1-76675 & NBP1-41439?
    • The antibodies NBP1-77251 and NBP1-76675 are specific to ATF6 alpha and should not cross-react with ATF6 beta.

Additional ATF6 Products

Research Areas for ATF6 Partial Recombinant Protein (H00022926-Q01)

Find related products by research area.

Blogs on ATF6.

ATF6 - monitoring and regulating protein folding under cellular stress
During times of cellular stress overloading of the protein folding machinery leads to the accumulation of incorrectly folded proteins. This triggers the unfolded protein response (UPR) in order to try to reestablish homeostasis or, if this fails, t...  Read full blog post.

ATF6 - a key target in alcohol-induced fatty liver disease?
The ATF6 endoplasmic reticulum (ER) stress-regulated transcription factor is constitutively expressed and plays a central role in the mammalian unfolded protein response (UPR). This fundamental pathway is responsible for balancing cellular hom...  Read full blog post.

A Key to Fight Stress: ATF6
The protein ATF6 is a constitutively expressed transcription factor that is a key mediator of the unfolded protein response (UPR) that allows mammalian cells to maintain cellular homeostasis under conditions of environmental and physiological stress. ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATF6 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF6