| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 91-193 of Human ATF6 Source: Wheat Germ (in vitro) Amino Acid Sequence: QPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQ |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | ATF6 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 37.07 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for ATF6 Partial Recombinant Protein (H00022926-Q01)Find related products by research area.
|
|
ATF6 - monitoring and regulating protein folding under cellular stress During times of cellular stress overloading of the protein folding machinery leads to the accumulation of incorrectly folded proteins. This triggers the unfolded protein response (UPR) in order to try to reestablish homeostasis or, if this fails, t... Read full blog post. |
|
ATF6 - a key target in alcohol-induced fatty liver disease? The ATF6 endoplasmic reticulum (ER) stress-regulated transcription factor is constitutively expressed and plays a central role in the mammalian unfolded protein response (UPR). This fundamental pathway is responsible for balancing cellular hom... Read full blog post. |
|
A Key to Fight Stress: ATF6 The protein ATF6 is a constitutively expressed transcription factor that is a key mediator of the unfolded protein response (UPR) that allows mammalian cells to maintain cellular homeostasis under conditions of environmental and physiological stress. ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATF6 |