Home » ATCAY » ATCAY Antibodies » ATCAY Antibody

ATCAY Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining in human cerebral cortex and pancreas tissues using anti-ATCAY antibody. Corresponding ATCAY RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining in human cerebral cortex and pancreas tissues using anti-ATCAY antibody. Corresponding ATCAY RNA-seq data are presented ...read more
Immunohistochemistry: ATCAY Antibody [NBP2-48537] - Staining of human cerebellum shows moderate cytoplasmic positivity in subsets of cells.
Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ATCAY Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSWFIRTVLAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATCAY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATCAY Recombinant Protein Antigen (NBP2-48537PEP)

Reactivity Notes

Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATCAY Antibody

  • Ataxia cayman type protein
  • ataxia, cerebellar, Cayman type
  • BNIP-H
  • caytaxin
  • CLAC
  • KIAA1872Cayman ataxia

Background

ATCAY encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Collagen XXV alpha
1 Antibody
AF4317
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Collagen XXV  alpha 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4317) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Collagen XXV  alpha 1 at approximately 65 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
Glutaminase
Antibody
NBP1-89766
Immunocytochemistry/Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining of human cell line SiHa shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) - BSA Free [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28584278/) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(49 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
PDZD2/PDZK3
Antibody (787924)
MAB7670
Western blot shows lysates of human prostate tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PDZD2 at approximately 37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PDZD2 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human PDZD2 Monoclonal Antibody (Catalog # MAB7670) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, WB
CRHR1/CRF1 Antibody
NBP1-00175
Immunocytochemistry/Immunofluorescence: CRHR1/CRF1 Antibody [NBP1-00175] - Immunofluorescence analysis of paraformaldehyde fixed Neuro2a cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing plasma membrane, and vesicle staining. The nuclear stain is DAPI (blue).Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunocytochemistry/Immunofluorescence: CRHR1/CRF1 Antibody [NBP1-00175] - Immunofluorescence analysis of paraformaldehyde fixed MCF7 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic and vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Western Blot: CRHR1/CRF1 Antibody [NBP1-00175] - Staining of Human Colon (A), Cerebellum (B), Rat Brain (C) and Mouse spinal Cord (D) lysates (35 ug protein in RIPA buffer). Antibody at 1 ug/mL. Detected by chemiluminescence.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
MEK2 Antibody
(OTI1A2)
NBP2-45802
Immunofluorescence: MEK2 Antibody (OTI1A2) [NBP2-45802] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY MEK2.
Immunohistochemistry: MEK2 Antibody (OTI1A2) [NBP2-45802] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: MEK2 Antibody (OTI1A2) [NBP2-45802] - Analysis of Carcinoma of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
Alpha-TTP Antibody
NBP2-14870
Immunohistochemistry-Paraffin: Alpha-TTP Antibody [NBP2-14870] - Gastric cancer. alpha TTP antibody [C2C3], C-term dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Alpha-TTP Antibody [NBP2-14870] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with alpha TTP antibody [C2C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Alpha-TTP Antibody [NBP2-14870] - Mouse tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with alpha TTP antibody [C2C3], C-term diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
Reg1A/B Antibody
[Unconjugated]
AF4937
Reg1A was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pancreas tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Reg1A at approximately 20-22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IHC, WB
NXF1 Antibody
NBP1-31649
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
S100A9 Antibody
[Unconjugated]
AF2065
S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counte­rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
S100A9 was detected in perfusion fixed frozen sections of mouse spleen using Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) at 0.3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in splenocytes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
S100A9 was detected in immersion fixed mouse splenocytes using Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Reviews)
(21 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
p19 INK4d Antibody
(2E10)
H00001032-M08
Western Blot: p19 INK4d Antibody (2E10) [H00001032-M08] - Analysis of CDKN2D expression in transfected 293T cell line by CDKN2D monoclonal antibody (M08), clone 2E10. Lane 1: CDKN2D transfected lysatE (17.7 KDa). Lane 2: Non-transfected lysate.
Immunoprecipitation: p19 INK4d Antibody (2E10) [H00001032-M08] - Analysis of CDKN2D transfected lysate using anti-CDKN2D monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDKN2D rabbit polyclonal antibody.
Sandwich ELISA: p19 INK4d Antibody (2E10) [H00001032-M08] - Detection limit for recombinant GST tagged CDKN2D is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Kir3.1 Antibody
(OTI1G3)
NBP2-01702
Flow Cytometry: Kir3.1 Antibody (1G3) [NBP2-01702] - Analysis of Jurkat cells, using anti-Kir3.1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Kir3.1 Antibody (1G3) [NBP2-01702] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Kir3.1 antibody, and then analyzed by flow cytometry.
Western Blot: Kir3.1 Antibody (1G3) [NBP2-01702] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Kir3.1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Kir3.1.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human tonsil shows strong nuclear positivity in non - germinal center cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ATCAY Antibody
NBP2-48537
ATCAY Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for ATCAY Antibody (NBP2-48537) (0)

There are no publications for ATCAY Antibody (NBP2-48537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATCAY Antibody (NBP2-48537) (0)

There are no reviews for ATCAY Antibody (NBP2-48537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATCAY Antibody (NBP2-48537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATCAY Products

Array NBP2-48537

Bioinformatics Tool for ATCAY Antibody (NBP2-48537)

Discover related pathways, diseases and genes to ATCAY Antibody (NBP2-48537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATCAY Antibody (NBP2-48537)

Discover more about diseases related to ATCAY Antibody (NBP2-48537).
 

Pathways for ATCAY Antibody (NBP2-48537)

View related products by pathway.

PTMs for ATCAY Antibody (NBP2-48537)

Learn more about PTMs related to ATCAY Antibody (NBP2-48537).

Blogs on ATCAY

There are no specific blogs for ATCAY, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATCAY Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATCAY