ATCAY Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining in human cerebral cortex and pancreas tissues using anti-ATCAY antibody. Corresponding ATCAY RNA-seq data are presented ...read more
Immunohistochemistry: ATCAY Antibody [NBP2-48537] - Staining of human cerebellum shows moderate cytoplasmic positivity in subsets of cells.
Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: ATCAY Antibody [NBP2-48537] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ATCAY Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSWFIRTVLAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATCAY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATCAY Recombinant Protein Antigen (NBP2-48537PEP)

Reactivity Notes

Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATCAY Antibody

  • Ataxia cayman type protein
  • ataxia, cerebellar, Cayman type
  • BNIP-H
  • caytaxin
  • CLAC
  • KIAA1872Cayman ataxia

Background

ATCAY encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4317
Species: Hu
Applications: WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB7670
Species: Hu
Applications: ICC, WB
NBP1-00175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBP2-45802
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
NBP2-14870
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
AF4937
Species: Hu
Applications: IHC, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
H00001032-M08
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48537
Species: Hu
Applications: IHC, IHC-P

Publications for ATCAY Antibody (NBP2-48537) (0)

There are no publications for ATCAY Antibody (NBP2-48537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATCAY Antibody (NBP2-48537) (0)

There are no reviews for ATCAY Antibody (NBP2-48537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATCAY Antibody (NBP2-48537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATCAY Products

Array NBP2-48537

Bioinformatics Tool for ATCAY Antibody (NBP2-48537)

Discover related pathways, diseases and genes to ATCAY Antibody (NBP2-48537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATCAY Antibody (NBP2-48537)

Discover more about diseases related to ATCAY Antibody (NBP2-48537).
 

Pathways for ATCAY Antibody (NBP2-48537)

View related products by pathway.

PTMs for ATCAY Antibody (NBP2-48537)

Learn more about PTMs related to ATCAY Antibody (NBP2-48537).

Blogs on ATCAY

There are no specific blogs for ATCAY, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATCAY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATCAY