ATAD4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATAD4 Antibody [NBP1-90075] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ATAD4 Antibody [NBP1-90075] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATAD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRR15L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATAD4 Protein (NBP1-90075PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATAD4 Antibody

  • ATAD4
  • ATPase family, AAA domain containing 4
  • MGC11242
  • proline rich 15-like
  • proline-rich protein 15-like protein
  • Protein ATAD4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-12553
Species: Hu
AF4468
Species: Mu
Applications: WB
NB100-61604
Species: Hu, Sh
Applications: WB (-), IP
AF8064
Species: Hu
Applications: WB, IHC, ICC
H00114299-M09
Species: Hu, Rt
Applications: WB, ELISA
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for ATAD4 Antibody (NBP1-90075) (0)

There are no publications for ATAD4 Antibody (NBP1-90075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATAD4 Antibody (NBP1-90075) (0)

There are no reviews for ATAD4 Antibody (NBP1-90075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATAD4 Antibody (NBP1-90075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATAD4 Products

Bioinformatics Tool for ATAD4 Antibody (NBP1-90075)

Discover related pathways, diseases and genes to ATAD4 Antibody (NBP1-90075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ATAD4 Antibody (NBP1-90075)

Find related products by research area.

Blogs on ATAD4

There are no specific blogs for ATAD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRR15L