ASPDH Antibody

Images

 
Western Blot: ASPDH Antibody [NBP1-85832] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: ASPDH Antibody [NBP1-85832] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASPDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASPDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASPDH Protein (NBP1-85832PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASPDH Antibody

  • aspartate dehydrogenase domain containing
  • Aspartate dehydrogenase domain-containing protein
  • EC 1.4.1.21
  • putative L-aspartate dehydrogenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54755
Species: Hu
Applications: WB
NBP2-34980
Species: Hu
NBP1-85832
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ASPDH Antibody (NBP1-85832) (0)

There are no publications for ASPDH Antibody (NBP1-85832).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASPDH Antibody (NBP1-85832) (0)

There are no reviews for ASPDH Antibody (NBP1-85832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASPDH Antibody (NBP1-85832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASPDH Products

Bioinformatics Tool for ASPDH Antibody (NBP1-85832)

Discover related pathways, diseases and genes to ASPDH Antibody (NBP1-85832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for ASPDH Antibody (NBP1-85832)

Learn more about PTMs related to ASPDH Antibody (NBP1-85832).

Blogs on ASPDH

There are no specific blogs for ASPDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASPDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPDH