Aspartate beta hydroxylase Antibody (3G5)

Images

 
Sandwich ELISA: Aspartate beta hydroxylase Antibody (3G5) [H00000444-M09] - Detection limit for recombinant GST tagged ASPH is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aspartate beta hydroxylase Antibody (3G5) Summary

Immunogen
ASPH (NP_115857 161 a.a. - 270 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPE
Specificity
ASPH - aspartate beta-hydroxylase (3G5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASPH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aspartate beta hydroxylase Antibody (3G5)

  • AAH
  • ASP beta-hydroxylase
  • aspartate beta-hydroxylaseA beta H-J-J
  • aspartyl/asparaginyl-beta-hydroxylase
  • BAH
  • cardiac junctin
  • CASQ2BP1
  • EC 1.14.11.16
  • HAAHaspartyl/asparaginyl beta-hydroxylase
  • humbug
  • JCTN
  • junctate
  • junctin
  • Peptide-aspartate beta-dioxygenase

Background

This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00000444-M09
Species: Hu
Applications: WB, ELISA

Publications for Aspartate beta hydroxylase Antibody (H00000444-M09) (0)

There are no publications for Aspartate beta hydroxylase Antibody (H00000444-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aspartate beta hydroxylase Antibody (H00000444-M09) (0)

There are no reviews for Aspartate beta hydroxylase Antibody (H00000444-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aspartate beta hydroxylase Antibody (H00000444-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aspartate beta hydroxylase Products

Bioinformatics Tool for Aspartate beta hydroxylase Antibody (H00000444-M09)

Discover related pathways, diseases and genes to Aspartate beta hydroxylase Antibody (H00000444-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartate beta hydroxylase Antibody (H00000444-M09)

Discover more about diseases related to Aspartate beta hydroxylase Antibody (H00000444-M09).
 

Pathways for Aspartate beta hydroxylase Antibody (H00000444-M09)

View related products by pathway.

PTMs for Aspartate beta hydroxylase Antibody (H00000444-M09)

Learn more about PTMs related to Aspartate beta hydroxylase Antibody (H00000444-M09).
 

Research Areas for Aspartate beta hydroxylase Antibody (H00000444-M09)

Find related products by research area.

Blogs on Aspartate beta hydroxylase

There are no specific blogs for Aspartate beta hydroxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aspartate beta hydroxylase Antibody (3G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPH
Entrez
Uniprot