Recombinant Human ASCL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ASCL3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-181 of Human ASCL3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ASCL3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ASCL3 Protein

  • achaete-scute complex homolog 3 (Drosophila)
  • ASH-3
  • bHLH transcription factor Sgn-1 (Salivary Glands 1)
  • bHLH transcriptional regulator Sgn-1
  • BHLHA42
  • bHLHa42achaete-scute homolog 3
  • Class A basic helix-loop-helix protein 42
  • hASH3
  • HASH3achaete-scute complex (Drosophila) homolog-like 3
  • Sgn1

Background

Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-22478
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-90762
Species: Hu
Applications: IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46420
Species: Hu
Applications: WB, IHC
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00056676-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ASCL3 Recombinant Protein (H00056676-P01) (0)

There are no publications for ASCL3 Recombinant Protein (H00056676-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL3 Recombinant Protein (H00056676-P01) (0)

There are no reviews for ASCL3 Recombinant Protein (H00056676-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASCL3 Recombinant Protein (H00056676-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASCL3 Products

Bioinformatics Tool for ASCL3 Recombinant Protein (H00056676-P01)

Discover related pathways, diseases and genes to ASCL3 Recombinant Protein (H00056676-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL3 Recombinant Protein (H00056676-P01)

Discover more about diseases related to ASCL3 Recombinant Protein (H00056676-P01).
 

Pathways for ASCL3 Recombinant Protein (H00056676-P01)

View related products by pathway.

PTMs for ASCL3 Recombinant Protein (H00056676-P01)

Learn more about PTMs related to ASCL3 Recombinant Protein (H00056676-P01).

Blogs on ASCL3

There are no specific blogs for ASCL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ASCL3 Antibody
NBP1-88635
eIF4G1 Antibody
NB100-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ASCL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCL3