Recombinant Human ASCL3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ASCL3 Protein [H00056676-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human ASCL3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-95 of Human ASCL3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ASCL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ASCL3 GST (N-Term) Protein

  • achaete-scute complex homolog 3 (Drosophila)
  • ASH-3
  • bHLH transcription factor Sgn-1 (Salivary Glands 1)
  • bHLH transcriptional regulator Sgn-1
  • BHLHA42
  • bHLHa42achaete-scute homolog 3
  • Class A basic helix-loop-helix protein 42
  • hASH3
  • HASH3achaete-scute complex (Drosophila) homolog-like 3
  • SGN1

Background

Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-30979
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-92741
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP2-15253
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-46420
Species: Hu, Mu, Rt
Applications: IHC, WB
NB110-99585
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-57150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-56916
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
AF1678
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
H00056676-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for ASCL3 Partial Recombinant Protein (H00056676-Q01) (0)

There are no publications for ASCL3 Partial Recombinant Protein (H00056676-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL3 Partial Recombinant Protein (H00056676-Q01) (0)

There are no reviews for ASCL3 Partial Recombinant Protein (H00056676-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASCL3 Partial Recombinant Protein (H00056676-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASCL3 Products

Bioinformatics Tool for ASCL3 Partial Recombinant Protein (H00056676-Q01)

Discover related pathways, diseases and genes to ASCL3 Partial Recombinant Protein (H00056676-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL3 Partial Recombinant Protein (H00056676-Q01)

Discover more about diseases related to ASCL3 Partial Recombinant Protein (H00056676-Q01).
 

Pathways for ASCL3 Partial Recombinant Protein (H00056676-Q01)

View related products by pathway.

PTMs for ASCL3 Partial Recombinant Protein (H00056676-Q01)

Learn more about PTMs related to ASCL3 Partial Recombinant Protein (H00056676-Q01).

Blogs on ASCL3

There are no specific blogs for ASCL3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ASCL3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCL3