ASB13 Recombinant Protein Antigen

Images

 
There are currently no images for ASB13 Recombinant Protein Antigen (NBP2-57501PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASB13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASB13.

Source: E.coli

Amino Acid Sequence: KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASB13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57501 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ASB13 Recombinant Protein Antigen

  • ankyrin repeat and SOCS box containing 13
  • ankyrin repeat and SOCS box protein 13
  • ankyrin repeat and SOCS box-containing 13
  • ankyrin repeat domain-containing SOCS box protein Asb-13
  • ASB-13
  • FLJ13134
  • MGC19879

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-78626
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87724
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66192
Species: Hu
NBP2-47358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-90171
Species: Hu
Applications: IHC, IHC-P
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
NBP2-67800
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57501PEP
Species: Hu
Applications: AC

Publications for ASB13 Recombinant Protein Antigen (NBP2-57501PEP) (0)

There are no publications for ASB13 Recombinant Protein Antigen (NBP2-57501PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASB13 Recombinant Protein Antigen (NBP2-57501PEP) (0)

There are no reviews for ASB13 Recombinant Protein Antigen (NBP2-57501PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ASB13 Recombinant Protein Antigen (NBP2-57501PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ASB13 Recombinant Protein Antigen (NBP2-57501PEP)

Discover related pathways, diseases and genes to ASB13 Recombinant Protein Antigen (NBP2-57501PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASB13 Recombinant Protein Antigen (NBP2-57501PEP)

Discover more about diseases related to ASB13 Recombinant Protein Antigen (NBP2-57501PEP).
 

Pathways for ASB13 Recombinant Protein Antigen (NBP2-57501PEP)

View related products by pathway.

Research Areas for ASB13 Recombinant Protein Antigen (NBP2-57501PEP)

Find related products by research area.

Blogs on ASB13

There are no specific blogs for ASB13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ASB13 Antibody
NBP2-14320

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASB13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASB13