ARMER Recombinant Protein Antigen

Images

 
There are currently no images for ARMER Protein (NBP1-91681PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ARMER Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARL6IP1.

Source: E. coli

Amino Acid Sequence: FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARL6IP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91681.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARMER Recombinant Protein Antigen

  • ADP-ribosylation factor-like 6 interacting protein 1
  • ADP-ribosylation factor-like 6 interacting protein
  • AIP1
  • Aip-1
  • apoptotic regulator in the membrane of the endoplasmic reticulum
  • ARL-6-interacting protein 1
  • ARL6IPaip-1
  • ARMER
  • KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Background

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
MAB6015
Species: Hu, Mu, Rt
Applications: WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-32665
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-112
Species: Ca, Ha, Hu, Pm, Mu, Po, Rt, Ze
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, KD, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-37592
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85615
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-32254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-49557
Species: Hu
Applications: IHC,  IHC-P
NBP1-31347
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-90202
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for ARMER Protein (NBP1-91681PEP) (0)

There are no publications for ARMER Protein (NBP1-91681PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMER Protein (NBP1-91681PEP) (0)

There are no reviews for ARMER Protein (NBP1-91681PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARMER Protein (NBP1-91681PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARMER Products

Research Areas for ARMER Protein (NBP1-91681PEP)

Find related products by research area.

Blogs on ARMER

There are no specific blogs for ARMER, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARMER Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP1