Recombinant Human ARL8B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARL8B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-186 of Human ARL10C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ARL8B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARL8B Protein

  • ADP-ribosylation factor-like 10C
  • ADP-ribosylation factor-like 8B
  • ADP-ribosylation factor-like protein 10C
  • ADP-ribosylation factor-like protein 8B
  • ARL10C
  • FLJ10702
  • Gie1
  • Novel small G protein indispensable for equal chromosome segregation 1

Background

ARL10C( AAH13131, 1 a.a. - 187 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14316
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39010
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45795
Species: Hu
Applications: WB, IHC
NBP2-46016
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
H00055207-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARL8B Recombinant Protein (H00055207-P01) (0)

There are no publications for ARL8B Recombinant Protein (H00055207-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL8B Recombinant Protein (H00055207-P01) (0)

There are no reviews for ARL8B Recombinant Protein (H00055207-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL8B Recombinant Protein (H00055207-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL8B Products

Bioinformatics Tool for ARL8B Recombinant Protein (H00055207-P01)

Discover related pathways, diseases and genes to ARL8B Recombinant Protein (H00055207-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL8B Recombinant Protein (H00055207-P01)

Discover more about diseases related to ARL8B Recombinant Protein (H00055207-P01).
 

Pathways for ARL8B Recombinant Protein (H00055207-P01)

View related products by pathway.

PTMs for ARL8B Recombinant Protein (H00055207-P01)

Learn more about PTMs related to ARL8B Recombinant Protein (H00055207-P01).
 

Research Areas for ARL8B Recombinant Protein (H00055207-P01)

Find related products by research area.

Blogs on ARL8B

There are no specific blogs for ARL8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARL8B Antibody
NBP1-56577
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARL8B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL8B