Recombinant Human ARL6IP4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARL6IP4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 261-360 of Human ARL6IP4

Source: Wheat Germ

Amino Acid Sequence: PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARL6IP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARL6IP4 Protein

  • ADP-ribosylation-like factor 6 interacting protein 4
  • Aip-4
  • ARL-6-interacting protein 4
  • HSP-975
  • HSVI binding protein
  • HSVI-binding protein
  • MGC814
  • SFRS20
  • splicing factor, arginine/serine-rich 20
  • splicing regulator SRrp38
  • SR-15
  • SR-25ADP-ribosylation factor-like protein 6-interacting protein 4
  • SRp25 nuclear protein
  • SRp25aip-4
  • SRrp37

Background

ARL6IP4 - ADP-ribosylation-like factor 6 interacting protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP1-90202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NB100-127
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-86769
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-85993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-65087
Species: Hu
NBP2-49637
Species: Hu
Applications: WB, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for ARL6IP4 Partial Recombinant Protein (H00051329-Q01) (0)

There are no publications for ARL6IP4 Partial Recombinant Protein (H00051329-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL6IP4 Partial Recombinant Protein (H00051329-Q01) (0)

There are no reviews for ARL6IP4 Partial Recombinant Protein (H00051329-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL6IP4 Partial Recombinant Protein (H00051329-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL6IP4 Products

Bioinformatics Tool for ARL6IP4 Partial Recombinant Protein (H00051329-Q01)

Discover related pathways, diseases and genes to ARL6IP4 Partial Recombinant Protein (H00051329-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL6IP4 Partial Recombinant Protein (H00051329-Q01)

Discover more about diseases related to ARL6IP4 Partial Recombinant Protein (H00051329-Q01).
 

Pathways for ARL6IP4 Partial Recombinant Protein (H00051329-Q01)

View related products by pathway.

PTMs for ARL6IP4 Partial Recombinant Protein (H00051329-Q01)

Learn more about PTMs related to ARL6IP4 Partial Recombinant Protein (H00051329-Q01).

Blogs on ARL6IP4

There are no specific blogs for ARL6IP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARL6IP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP4