We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ARL4 Recombinant Protein Antigen

Images

 
There are currently no images for ARL4 Recombinant Protein Antigen (NBP2-55774PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ARL4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARL4.

Source: E. coli

Amino Acid Sequence: MGNGLSDQTSILSNLPSFQSFHIVILGLDC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARL4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55774.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARL4 Recombinant Protein Antigen

  • ADP-ribosylation factor-like 4A
  • ADP-ribosylation factor-like protein 4A
  • ARL4ADP-ribosylation factor-like 4

Background

ADP-ribosylation factor-like 4A is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extranuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-92876
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-47960
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP3-44913
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-04024
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-92831
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00007873-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB4675
Species: Mu
Applications: IHC, Neut, WB
NBP2-14306
Species: Hu
Applications: IHC,  IHC-P, WB
H00000473-M06
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6260
Species: Hu
Applications: WB
H00057016-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-1078
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
AF640
Species: Mu
Applications: IHC, WB
H00007071-M15
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-15910
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ARL4 Recombinant Protein Antigen (NBP2-55774PEP) (0)

There are no publications for ARL4 Recombinant Protein Antigen (NBP2-55774PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL4 Recombinant Protein Antigen (NBP2-55774PEP) (0)

There are no reviews for ARL4 Recombinant Protein Antigen (NBP2-55774PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARL4 Recombinant Protein Antigen (NBP2-55774PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARL4 Products

Research Areas for ARL4 Recombinant Protein Antigen (NBP2-55774PEP)

Find related products by research area.

Blogs on ARL4

There are no specific blogs for ARL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARL4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL4A